[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64376.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   26->326 1dotA PDBj 2e-24 18.9 %
:RPS:SCOP  38->303 1us4A  c.94.1.1 * 1e-11 16.2 %
:HMM:SCOP  36->326 1dotA1 c.94.1.2 * 2.3e-43 26.0 %
:HMM:PFM   132->244 PF00497 * SBP_bac_3 0.00023 27.6 87/225  
:HMM:PFM   71->187 PF00405 * Transferrin 1.4e-05 29.7 111/330  
:BLT:SWISS 56->298 PTXB_PSEST 2e-07 25.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64376.1 GT:GENE AAL64376.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1604799..1605785 GB:FROM 1604799 GB:TO 1605785 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64376.1 GB:DB_XREF GI:18161068 LENGTH 328 SQ:AASEQ MAIGKKALIIAGVLAVVIVAAVLALQNYPAQTPQSGAAQGKFRIVVNPGVAEKVSIKEAQELEKYLEDLMGMDVELSYPASSAALIEALRFGHADAALGPGALVGALAVSLANAELVAVEYREVIIDGKRETAPYYYSYFIVLKESPYVYIDELRGKRVCFPSETSVSGFIMPLKALADRGYITPGEVERPRDLALQFFGDVVFGGGYAQCWAALKEGKVDVTVMAGDVAASLYWEAMNNSRVLKWKDGGYAIAGPNPSHVVLVRGDLPEDVKTKFVNAIFALNNKPELMRNYVSAIFVRFERRDVNEHLKPLIDALDYLKIKEFYLR GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 56->298|PTXB_PSEST|2e-07|25.2|218/287| TM:NTM 1 TM:REGION 7->26| SEG 7->25|aliiagvlavvivaavlal| SEG 94->114|adaalgpgalvgalavslana| RP:PDB:NREP 1 RP:PDB:REP 26->326|1dotA|2e-24|18.9|285/686| HM:PFM:NREP 2 HM:PFM:REP 132->244|PF00497|0.00023|27.6|87/225|SBP_bac_3| HM:PFM:REP 71->187|PF00405|1.4e-05|29.7|111/330|Transferrin| RP:SCP:NREP 1 RP:SCP:REP 38->303|1us4A|1e-11|16.2|247/298|c.94.1.1| HM:SCP:REP 36->326|1dotA1|2.3e-43|26.0|277/0|c.94.1.2|1/1|Periplasmic binding protein-like II| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN ------------------1-----------------------------------------------11 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------1---------------------1-------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 301 STR:RPRED 91.8 SQ:SECSTR #########################HHHHcccccccccTTcEEEEEEcHHHHHccHHHHHHHHHHHHHHTTccEEEEEEcccHHHHHHHHTTccccEEEcHHHHHHHHTTTcEcEEEEEEccTTccccccccccccEEEEEEEcccccccGGGcTTcccccccTTcTTTTHHHHHHHHHHHccccTTccTTcGGGccccccccccccTTTTcccTTcHHHHHHHHTcccETTcHHHHccccccccTcGGGcEEEcTTcccEEEEcTTTHHHHHHHHHHHHHcTTcTTTTccTTcccccccccccTTccEEEEccTTccHHHHHHHH## DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHcccEEEEEccccHHHHHHHHHccccEEEccccEEEEccccccccEEEEEEEEEcccccccHHHHcccEEEEcccccHHHHHHHHHHHHHHccccHHHHcccccccHHHcccEEccccHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEccccHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccEEccc //