[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64393.1
DDBJ      :             P. aerophilum family 66 protein, interruption-N
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64393.1 GT:GENE AAL64393.1 GT:PRODUCT P. aerophilum family 66 protein, interruption-N GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1617678..1618208) GB:FROM 1617678 GB:TO 1618208 GB:DIRECTION - GB:PRODUCT P. aerophilum family 66 protein, interruption-N GB:NOTE Hypothetical; Conserved within genome GB:PROTEIN_ID AAL64393.1 GB:DB_XREF GI:18161086 LENGTH 176 SQ:AASEQ MSNWALAVISLVALIYATQIEVYVDNGPDVDGLHIYVWVGQRWEPVEVVYVPQSVETYIVATGEWTTMPYYNASRYILRLPREALFPRGRGELPRGFERWTLEVDNGTRRVVVDITRAAYEAFRRYLKCTGTEAELVEPPPPPGRPVEERYCKQYGLYCGEMCNYVKIYGVSRREK GT:EXON 1|1-176:0| TM:NTM 1 TM:REGION 2->24| SEG 133->150|eaelvepppppgrpveer| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN ------------------2------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 174-176| PSIPRED cccHHHHHHHHHHHHHHEEEEEEEcccccccEEEEEEEEcccccEEEEEEEccEEEEEEEEcccEEEEccccHHHHHHcccHHHHccccccccccccEEEEEEEEcccEEEEEEEHHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHccHHHHHccEEEEEEcccccc //