[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64402.1
DDBJ      :             2-oxoacid ferredoxin oxidoreductase beta subunit
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  247/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.36.1
:317 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   12->202 3ea4A PDBj 3e-17 15.9 %
:RPS:SCOP  17->198 1bfdA3  c.36.1.9 * 6e-17 18.8 %
:HMM:SCOP  15->274 1b0pA2 c.36.1.12 * 6.6e-67 39.3 %
:RPS:PFM   52->197 PF02775 * TPP_enzyme_C 5e-07 29.9 %
:RPS:PFM   202->273 PF12367 * PFO_beta_C 3e-11 41.0 %
:HMM:PFM   51->198 PF02775 * TPP_enzyme_C 3e-32 38.4 138/150  
:HMM:PFM   202->273 PF12367 * PFO_beta_C 3.3e-13 40.7 59/67  
:BLT:SWISS 18->205 KORB_METJA 1e-36 39.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64402.1 GT:GENE AAL64402.1 GT:PRODUCT 2-oxoacid ferredoxin oxidoreductase beta subunit GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1625703..1626656 GB:FROM 1625703 GB:TO 1626656 GB:DIRECTION + GB:PRODUCT 2-oxoacid ferredoxin oxidoreductase beta subunit GB:NOTE Energy metabolism; Electron transport GB:PROTEIN_ID AAL64402.1 GB:DB_XREF GI:18161095 LENGTH 317 SQ:AASEQ MATEIKPEHFRPPIWNDWCPGCGDFGILSAMYQAFAELKLKPLDLVVVSGIGCSGKTPHYINAGGVHTLHGRALPFAQGIKIANPNLTVVVNVGDGDLLGIGSAHFVAMGRRNIDIVVIMHNNTVYGLTKGQASPTLRLGEQPKSLPKPNIQSAVNPIALALASGYTFVARGYAARVPHLKELIKQAILHKGSAFIDVLQPCVTFDNIHTYDYYNKRVYDVQEEDKWDPVADTPEKRWEKLKGALQYAYADGERIPIGVFYVDKTVPPFEERLLSRMPKYLEAPPALQKIEENGAPAINQNVFKQLFKRNIIEIGKR GT:EXON 1|1-317:0| BL:SWS:NREP 1 BL:SWS:REP 18->205|KORB_METJA|1e-36|39.4|188/270| SEG 89->102|vvvnvgdgdllgig| RP:PDB:NREP 1 RP:PDB:REP 12->202|3ea4A|3e-17|15.9|189/581| RP:PFM:NREP 2 RP:PFM:REP 52->197|PF02775|5e-07|29.9|134/139|TPP_enzyme_C| RP:PFM:REP 202->273|PF12367|3e-11|41.0|61/69|PFO_beta_C| HM:PFM:NREP 2 HM:PFM:REP 51->198|PF02775|3e-32|38.4|138/150|TPP_enzyme_C| HM:PFM:REP 202->273|PF12367|3.3e-13|40.7|59/67|PFO_beta_C| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02775|IPR011766| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02775|IPR011766| RP:SCP:NREP 1 RP:SCP:REP 17->198|1bfdA3|6e-17|18.8|170/183|c.36.1.9| HM:SCP:REP 15->274|1b0pA2|6.6e-67|39.3|244/0|c.36.1.12|1/1|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 484 OP:NHOMOORG 315 OP:PATTERN 22111112111111122233211222222223213112333332212212222123223332221-11 133-1---------11111-11--1111111111111-121222----------------11111111211--------1----21-122121222-1-------1--1----------------1112121211222211---1-----------------------------------------11111-1-111111111111111-1----1111111-1-------1111111111111111111111-----------------------------------------------------------------------3312-1--111-1-1-------1-1--2--3----2222432223-3--111---1-------111---11212----------------------------------------1-----------------------1-1------------------------------1111-----------------------------------------------11---1----------------3---242333312233312224222223343--241111111111111111111111111------------------------------11----2----------------------------------------------------------------------------------------------------1111----------------------------------------------------------1------------------------------1-------------------------------------------2333223232-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 292 STR:RPRED 92.1 SQ:SECSTR HHHHHHHHHHHcccccccTTcccHHHHHHHHHHHHTTccEEEEccHHHHHHHcccccTTcEEcccccccTTcHHHHHHHHHHHcTTccEEEEEEHHHHHHTTTHHHHHHHHTTccEEEEEEEccccHHHHHHHHHHcTTcccccccccGGGTTcccccHHHHHHHTTccEEEEEccGGGHHHHHHHHHHccccEEEEEEccTEcccccccTTcHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHTTcccccHHHHHHHHHHHHHccccHHHHHHHH######################### DISOP:02AL 316-318| PSIPRED ccccccHHHcccccccccccccccHHHHHHHHHHHHHHccccccEEEEccccccccccccEEcccHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHccHHHHHHHHHccccEEEEEEEccHHccccccccccccccccEEccccccccccccHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHcccccccEEcHHHHHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccc //