[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64438.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:162 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64438.1 GT:GENE AAL64438.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1651980..1652468) GB:FROM 1651980 GB:TO 1652468 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64438.1 GB:DB_XREF GI:18161134 LENGTH 162 SQ:AASEQ MRTLLIYSKDWRDEATLRLYKAFTVLLQKQRAYALEKIAAKSPARALVFTYPCGWHGDVLFIAPYVVAVGPFEKDAILEFVLALPDRVALTLLEGGWTIEEVFKEFGPFDIGVACVGAPVKGVRRYVHKMVIIKVEGPVGDLISTLYAPEEEEADEVITAPP GT:EXON 1|1-162:0| TM:NTM 2 TM:REGION 49->71| TM:REGION 76->98| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN ------------------11-11--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,39-39,45-45,48-48,53-53| PSIPRED ccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccEEEEEcHHHccccccHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHccccEEHHHcccHHHHHHHHHHEEEEEEEcccHHHHHHHHccccHHHHHHcccccc //