[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64443.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:110 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->99 2pfwB PDBj 2e-08 33.9 %
:RPS:PDB   15->107 2aacA PDBj 1e-14 9.7 %
:RPS:SCOP  12->97 1yhfA1  b.82.1.9 * 8e-20 23.3 %
:HMM:SCOP  1->95 1sq4A_ b.82.1.11 * 4.9e-21 34.7 %
:RPS:PFM   38->81 PF07883 * Cupin_2 7e-07 43.2 %
:HMM:PFM   28->91 PF07883 * Cupin_2 4.7e-17 31.2 64/71  
:BLT:SWISS 15->97 Y3923_STRCO 1e-07 30.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64443.1 GT:GENE AAL64443.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1655939..1656271) GB:FROM 1655939 GB:TO 1656271 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64443.1 GB:DB_XREF GI:18161139 LENGTH 110 SQ:AASEQ MSWRWEKLSDCVERRYISGENVTVAQFILKEGCVVQRHSHPNEQITVVLQGLLEFDLGGRRLTAAAGDVVHIPPGVEHEVKAITDAVVIDVFSPPRSDWARGQDSYLRKN GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 15->97|Y3923_STRCO|1e-07|30.1|83/105| BL:PDB:NREP 1 BL:PDB:REP 38->99|2pfwB|2e-08|33.9|62/108| RP:PDB:NREP 1 RP:PDB:REP 15->107|2aacA|1e-14|9.7|93/163| RP:PFM:NREP 1 RP:PFM:REP 38->81|PF07883|7e-07|43.2|44/70|Cupin_2| HM:PFM:NREP 1 HM:PFM:REP 28->91|PF07883|4.7e-17|31.2|64/71|Cupin_2| RP:SCP:NREP 1 RP:SCP:REP 12->97|1yhfA1|8e-20|23.3|86/112|b.82.1.9| HM:SCP:REP 1->95|1sq4A_|4.9e-21|34.7|95/273|b.82.1.11|1/1|RmlC-like cupins| OP:NHOMO 55 OP:NHOMOORG 52 OP:PATTERN -----------------111-11-1--1--1---------------------------------1--- 112-----------------------------------------------------------------------------------------------------11-111--------------------1-----12211----1----------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------1-1----------------------------------------------1---------------------------------------------1-------------------------------------------------------------------------------------------1--------1111-1-----------------------------------------------1--------------------1------------------------------------------------------------------------------11---1-------------------------------111----1-----------------------------------------------------------1-1---------------------------------------------------1------1-11-----------------1-----------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 100.0 SQ:SECSTR cccTTTcEEEcccccccEEEEEEEETTcTTcccEEETTccccEEEEEEEEEcEEEEETTEEEEEcTTcEEEEcTTccEEEEEcTTEEEEEEEEEcccGGGGGGccccEEE DISOP:02AL 107-110| PSIPRED ccEEEEcccccEEEEEEccccEEEEEEEEccccccccccccccEEEEEEEEEEEEEEccEEEEEcccEEEEEccccEEEEEEccccEEEEEEccccccEEEccccccccc //