[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64452.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:44 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->26 PF09720 * Unstab_antitox 0.00017 34.8 23/54  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64452.1 GT:GENE AAL64452.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1661268..1661402) GB:FROM 1661268 GB:TO 1661402 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64452.1 GB:DB_XREF GI:18161149 LENGTH 44 SQ:AASEQ MPCEIAKRRLDLIKVGEEEAVELKAVGIERVVYAFCKAVGIIVQ GT:EXON 1|1-44:0| TM:NTM 1 TM:REGION 21->43| HM:PFM:NREP 1 HM:PFM:REP 4->26|PF09720|0.00017|34.8|23/54|Unstab_antitox| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------11------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcc //