[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64490.1
DDBJ      :             molybdopterin oxidoreductase, iron-sulfur binding subunit
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  514/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->77 2o01C PDBj 7e-04 44.0 %
:BLT:PDB   62->188 2vpyB PDBj 2e-24 41.9 %
:RPS:PDB   62->154 1a6lA PDBj 2e-10 24.4 %
:RPS:SCOP  1->183 1ti2B2  d.58.1.5 * 3e-40 24.4 %
:HMM:SCOP  1->185 1q16B_ d.58.1.5 * 2.8e-60 38.3 %
:HMM:PFM   8->23 PF00037 * Fer4 7.5e-07 50.0 16/24  
:HMM:PFM   71->79 PF00037 * Fer4 0.001 77.8 9/24  
:HMM:PFM   92->109 PF00037 * Fer4 9.4e-10 50.0 18/24  
:HMM:PFM   139->147 PF00037 * Fer4 0.00058 88.9 9/24  
:BLT:SWISS 9->185 PSRB_WOLSU 7e-36 45.4 %
:PROS 95->106|PS00198|4FE4S_FER_1
:REPEAT 3|71->98|101->136|139->154

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64490.1 GT:GENE AAL64490.1 GT:PRODUCT molybdopterin oxidoreductase, iron-sulfur binding subunit GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1690389..1690955 GB:FROM 1690389 GB:TO 1690955 GB:DIRECTION + GB:PRODUCT molybdopterin oxidoreductase, iron-sulfur binding subunit GB:NOTE Energy metabolism; Electron transport GB:PROTEIN_ID AAL64490.1 GB:DB_XREF GI:18161189 LENGTH 188 SQ:AASEQ MTRLAHLWDQSRCIGCTACIAACNVANYSSDTKENKTWGWLRSNIRRIEILRGPRPMLLLVQCQHCDNAPCVAVCPTGASYKDVDGLVKMRPELCIGCKYCMVACPYEARWLDEDTGLPRKCMGEECLSRVSQGLQPVCVEVCPAGARAFGDIDNPTSEISRRLAKSRYIRLLENKGTEPKYFVVVGP GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 9->185|PSRB_WOLSU|7e-36|45.4|163/191| PROS 95->106|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 3|71->98|101->136|139->154| BL:PDB:NREP 2 BL:PDB:REP 13->77|2o01C|7e-04|44.0|50/80| BL:PDB:REP 62->188|2vpyB|2e-24|41.9|124/193| RP:PDB:NREP 1 RP:PDB:REP 62->154|1a6lA|2e-10|24.4|90/106| HM:PFM:NREP 4 HM:PFM:REP 8->23|PF00037|7.5e-07|50.0|16/24|Fer4| HM:PFM:REP 71->79|PF00037|0.001|77.8|9/24|Fer4| HM:PFM:REP 92->109|PF00037|9.4e-10|50.0|18/24|Fer4| HM:PFM:REP 139->147|PF00037|0.00058|88.9|9/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 1->183|1ti2B2|3e-40|24.4|180/195|d.58.1.5| HM:SCP:REP 1->185|1q16B_|2.8e-60|38.3|183/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2464 OP:NHOMOORG 569 OP:PATTERN 22121322344333324-5474473113-1131-322333333-1--13-21232--525----3--- -7911-11111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------6cS334222---------11-1-1-111111---------------2243333332344422333-4----------------------------------------211----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------132-11111111-1-1411-111-----9--13pm2355-3AB11131--1621--1------21--423-32--11111111112-2242232511----------1-1121-11212-1--31211111111311--8-4-----------------------------------122-3211212233333324444413222334211232241443325213124---23----------B3417C557AC8BB99F188697693-A9B9353727422112211-2-------2B3321174-111-----45886-5H9A9687BA7J8---1842------C5C9AA-GHHFGFEEGG-GGFHGFFGFGHFGFGGFFAAAA9621BHFGGHHHHHHGFHFGG79CBEDEF--555555555555---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------123-111111-------------------------------------11--1-111121 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 98.4 SQ:SECSTR ###EEEEEccGGGGccccccccTTcccTTccccccccTTccEEEEEEcccccccccHHHHHGGTTTcccHHHHHcTTccEEEccccEEEccTTTcccccccTTTcTTccEEEGGGccGGGTHHHHHHHHHHHHTTcccccccccccTTHHHHTTcGGGGcccHHHHHccccccEEEcccccEEEEccc DISOP:02AL 188-189| PSIPRED ccEEEEEEEHHHcccccHHHHHHHHHHcccccccccccEEEEEEEEEEEccccccEEEEEHHHcccccHHHHHHccccccEEccccEEEEcccccccccccHHHcccccEEEcccccEEEEEEEcccHHHHHcccccEEHHHcccccEEEEEHHHHHHHHHHHHHHcccEEccccccccccEEEEccc //