[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64491.1
DDBJ      :             molybdopterin oxidoreductase, membrane subunit
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:290 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   13->178 PF03916 * NrfD 6e-06 26.5 %
:HMM:PFM   11->285 PF03916 * NrfD 1.3e-27 35.8 265/313  
:BLT:SWISS 140->179 NRFD_ECOLI 2e-04 47.5 %
:PROS 225->239|PS00211|ABC_TRANSPORTER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64491.1 GT:GENE AAL64491.1 GT:PRODUCT molybdopterin oxidoreductase, membrane subunit GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1690952..1691824 GB:FROM 1690952 GB:TO 1691824 GB:DIRECTION + GB:PRODUCT molybdopterin oxidoreductase, membrane subunit GB:NOTE Energy metabolism; Electron transport GB:PROTEIN_ID AAL64491.1 GB:DB_XREF GI:18161190 LENGTH 290 SQ:AASEQ MTAFQEIWAPWLIGPFLWLAGIAGMGFVAYVLLKWIGVEERKREFSWILFLSIVLALVFVIADLSRPWNMPSAIMSAVFSGTFGWTKSWMAVGIVILLLGLILALLVAVRNSGVKAIAPLTDSKWFDILLALVGIAITIYSGFLIAATPGVPFWNTALLPVLWIISASVCAVALVKLMIHNEVASKTATRFGVALDVAKLLAIFALISLSLYGGSIAARQSAYALAYGELAAPFWIGVVGVGVVIPLLLGLALLKKENKLLGIIAAILALIGALLLRVLILQAGIFEPLV GT:EXON 1|1-290:0| BL:SWS:NREP 1 BL:SWS:REP 140->179|NRFD_ECOLI|2e-04|47.5|40/100| PROS 225->239|PS00211|ABC_TRANSPORTER_1|PDOC00185| TM:NTM 8 TM:REGION 14->36| TM:REGION 53->75| TM:REGION 90->112| TM:REGION 126->148| TM:REGION 158->180| TM:REGION 192->214| TM:REGION 230->252| TM:REGION 263->285| SEG 91->109|avgivilllglilallvav| SEG 200->211|llaifalislsl| SEG 237->285|gvvgvgvviplllglallkkenkllgiiaailaligalllrvlilqagi| RP:PFM:NREP 1 RP:PFM:REP 13->178|PF03916|6e-06|26.5|166/308|NrfD| HM:PFM:NREP 1 HM:PFM:REP 11->285|PF03916|1.3e-27|35.8|265/313|NrfD| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN ----------------1-112----------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 227-228,230-230,235-235| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //