[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64502.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->84 PF07913 * DUF1678 0.00034 36.4 44/202  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64502.1 GT:GENE AAL64502.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1701848..1702129 GB:FROM 1701848 GB:TO 1702129 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64502.1 GB:DB_XREF GI:18161202 LENGTH 93 SQ:AASEQ MSNAVEESANPRAGGKACLPNSQVSTDAEERKEGVYFIYPPSRHNVEEVPEELRVMLEAYREARRPRIKIGFIRVKKVIGVIYGSEDKAEGKR GT:EXON 1|1-93:0| HM:PFM:NREP 1 HM:PFM:REP 40->84|PF07913|0.00034|36.4|44/202|DUF1678| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------1-1----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16, 20-22, 24-28, 87-93| PSIPRED cccccccccccccccccccccccccccHHHHHccEEEEEccccccHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHccccccccccc //