[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64528.1
DDBJ      :             ribosomal protein S10
Swiss-Prot:RS10_PYRAE   RecName: Full=30S ribosomal protein S10P;

Homologs  Archaea  67/68 : Bacteria  694/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
d.58.15
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->103 2zkqj PDBj 4e-17 33.3 %
:RPS:PDB   7->105 3bbnJ PDBj 2e-21 31.6 %
:RPS:SCOP  8->104 1fjgJ  d.58.15.1 * 1e-21 39.6 %
:HMM:SCOP  8->105 1fjgJ_ d.58.15.1 * 2.3e-25 41.2 %
:RPS:PFM   9->105 PF00338 * Ribosomal_S10 6e-10 39.6 %
:HMM:PFM   9->104 PF00338 * Ribosomal_S10 4.9e-31 40.0 95/97  
:BLT:SWISS 1->106 RS10_PYRAE 3e-56 100.0 %
:PROS 32->47|PS00361|RIBOSOMAL_S10

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64528.1 GT:GENE AAL64528.1 GT:PRODUCT ribosomal protein S10 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1727794..1728114 GB:FROM 1727794 GB:TO 1728114 GB:DIRECTION + GB:PRODUCT ribosomal protein S10 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL64528.1 GB:DB_XREF GI:18161230 LENGTH 106 SQ:AASEQ MSLASRRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSGQGYHTFDHWEMRISKRLIDIEASERVLRRLMTIRVPDTVKIELQLI GT:EXON 1|1-106:0| SW:ID RS10_PYRAE SW:DE RecName: Full=30S ribosomal protein S10P; SW:GN Name=rps10p; OrderedLocusNames=PAE2907; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->106|RS10_PYRAE|3e-56|100.0|106/106| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 32->47|PS00361|RIBOSOMAL_S10|PDOC00312| BL:PDB:NREP 1 BL:PDB:REP 8->103|2zkqj|4e-17|33.3|96/97| RP:PDB:NREP 1 RP:PDB:REP 7->105|3bbnJ|2e-21|31.6|98/99| RP:PFM:NREP 1 RP:PFM:REP 9->105|PF00338|6e-10|39.6|96/97|Ribosomal_S10| HM:PFM:NREP 1 HM:PFM:REP 9->104|PF00338|4.9e-31|40.0|95/97|Ribosomal_S10| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00338|IPR001848| GO:PFM GO:0005622|"GO:intracellular"|PF00338|IPR001848| GO:PFM GO:0005840|"GO:ribosome"|PF00338|IPR001848| GO:PFM GO:0006412|"GO:translation"|PF00338|IPR001848| RP:SCP:NREP 1 RP:SCP:REP 8->104|1fjgJ|1e-21|39.6|96/98|d.58.15.1| HM:SCP:REP 8->105|1fjgJ_|2.3e-25|41.2|97/0|d.58.15.1|1/1|Ribosomal protein S10| OP:NHOMO 1017 OP:NHOMOORG 940 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111-11 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111-1----1---------1-----1-111111111111111-----1-----11111111-111111111111------111-1111------------1111111-11111111111111111111111111111111111111111111111111-11111-111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111--1-111111111111111111111---1-1111211111-1111111111111111111111---1--1--111--2-11111111111111-111111-----------1----1-1-----------------------------------1111111111111111111111111111111111111111111111111111111111-1-----111111111--1--------1---------11111--1---------------------------11111111111111111111111111-1111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111-1-1-----111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------1111211---1-11111111111---1--------1-------1-11111111-1- 1111111152--1112111111111111111111111111111111111111111111-11111111111111111111111111111-121111-1111111214-111122111111311112315-252-112--1-3111211---1--11111111-121111112112--2218212325495142111-111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 99.1 SQ:SECSTR cTTcTTcccEEEEEEccHHHHHHHTTHHHHTTTTTcccEEEEEEcccEEEEEccccccccccccccccEEEEEEEEEEEEcccHHHHHHHTTcccccccEEEEEc# DISOP:02AL 1-6| PSIPRED ccccccEEEEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEEccccEEEEEEEEccccccccccHHHEEEEEEEEEEEEcccHHHHHHHHccccccccEEEEEEc //