[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64541.1
DDBJ      :             NADH-ubiquinone oxidoreductase subunit
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  105/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.307.1
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->168 3i9v5 PDBj 9e-14 35.0 %
:RPS:SCOP  18->171 2fug51  d.307.1.1 * 2e-25 27.9 %
:HMM:SCOP  15->176 2fug51 d.307.1.1 * 1.8e-34 37.5 %
:RPS:PFM   52->166 PF00329 * Complex1_30kDa 5e-16 40.2 %
:HMM:PFM   52->166 PF00329 * Complex1_30kDa 6.5e-33 45.1 102/103  
:HMM:PFM   23->64 PF02244 * Propep_M14 0.00049 23.8 42/74  
:BLT:SWISS 57->172 NUOC_CHLT3 6e-16 43.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64541.1 GT:GENE AAL64541.1 GT:PRODUCT NADH-ubiquinone oxidoreductase subunit GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1738200..1738733) GB:FROM 1738200 GB:TO 1738733 GB:DIRECTION - GB:PRODUCT NADH-ubiquinone oxidoreductase subunit GB:NOTE Energy metabolism; Electron transport GB:PROTEIN_ID AAL64541.1 GB:DB_XREF GI:18161244 LENGTH 177 SQ:AASEQ MSAKIPPKCPPQADHPLLGKVKEALGALVLTHGVTPEGHLCVMVPPDKVRDVANAVKNMGFDHVLSLSAIDYMAEGKFVVMYVFASYLTPELKAQLLHVRTEIPRDNPKIASIADIFPSADYEERECHEMFGIWFEGNPNMGKRFLLDPDCCIDEKTGKPLYPLRKDFKVPDWGLMG GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 57->172|NUOC_CHLT3|6e-16|43.7|103/240| BL:PDB:NREP 1 BL:PDB:REP 38->168|3i9v5|9e-14|35.0|120/196| RP:PFM:NREP 1 RP:PFM:REP 52->166|PF00329|5e-16|40.2|102/103|Complex1_30kDa| HM:PFM:NREP 2 HM:PFM:REP 52->166|PF00329|6.5e-33|45.1|102/103|Complex1_30kDa| HM:PFM:REP 23->64|PF02244|0.00049|23.8|42/74|Propep_M14| GO:PFM:NREP 2 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF00329|IPR001268| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00329|IPR001268| RP:SCP:NREP 1 RP:SCP:REP 18->171|2fug51|2e-25|27.9|140/191|d.307.1.1| HM:SCP:REP 15->176|2fug51|1.8e-34|37.5|152/0|d.307.1.1|1/1|Nqo5-like| OP:NHOMO 149 OP:NHOMOORG 142 OP:PATTERN 111-11111111111121111111-------------------------1111-1111111---1-11 -1--1-------------------------------------------------------21---11-------------------------1---------------------------------1----11-1----2211---11111111111--11--11111111---------------11------11111111-111111------111-------------------------------------------------------------------------------------------------------------1-----------------------1--1-111-----11-------22----1-1--1---11111---11--------------------1----------------1------------1--------------------------------------------------------11111------11-------11-------------------------1----------------------------1---------1--2--1--------1--------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------11111-11-111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 67.8 SQ:SECSTR #####################################cccEEEccHHHHHHHHHHHHHTTcccEEEEEEEEcTTcccEEEEEEEccc##TTcccccEEEEEEEccccccccccTTTccTHHHHHHHHHHTcccccTTcccccc##cccc####TTccc###cTTcTTc######### DISOP:02AL 1-13| PSIPRED ccccccccccccHHHHHHHHHHHHHHcccEEEEEEcccEEEEEEcHHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEEEEcccccccccEEEEEEEEcccccccccHHHHccccccHHHHHHHHHcEEEcccccccccEEccccccccccccccccccccccccccccccc //