[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64548.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  19/915 : Eukaryota  42/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:194 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->190 3bdiA PDBj 2e-15 28.8 %
:RPS:PDB   1->193 3bdiA PDBj 5e-17 19.3 %
:RPS:SCOP  1->193 1imjA  c.69.1.23 * 2e-37 31.6 %
:HMM:SCOP  4->192 1a8sA_ c.69.1.12 * 9.7e-36 37.6 %
:RPS:PFM   137->176 PF00561 * Abhydrolase_1 3e-04 47.5 %
:HMM:PFM   129->186 PF00561 * Abhydrolase_1 4.1e-06 32.8 58/231  
:BLT:SWISS 7->37 BPA1_STRAU 2e-04 45.2 %
:BLT:SWISS 24->193 ABHEA_DANRE 3e-17 34.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64548.1 GT:GENE AAL64548.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1743917..1744501 GB:FROM 1743917 GB:TO 1744501 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64548.1 GB:DB_XREF GI:18161252 LENGTH 194 SQ:AASEQ MSEKFITVGGKRIRYISGGSGKPLVLLHGWSFNADTWVESGIFPSLASRYEVYAIDMPYGIKTKSERFKAARPEYAVFLRGVLDALGLPDPPLVGPSASGEVVLWYVAQRLPTKAAVVIGPVGLGEELLSKLKGVGVPILAIWGERDEISPPSNAELLRGIATTAVLKNAGHAAYLDRPEEFVKIVLEFLSQVY GT:EXON 1|1-194:0| BL:SWS:NREP 2 BL:SWS:REP 7->37|BPA1_STRAU|2e-04|45.2|31/275| BL:SWS:REP 24->193|ABHEA_DANRE|3e-17|34.9|169/270| SEG 122->136|vglgeellsklkgvg| BL:PDB:NREP 1 BL:PDB:REP 1->190|3bdiA|2e-15|28.8|184/199| RP:PDB:NREP 1 RP:PDB:REP 1->193|3bdiA|5e-17|19.3|192/199| RP:PFM:NREP 1 RP:PFM:REP 137->176|PF00561|3e-04|47.5|40/211|Abhydrolase_1| HM:PFM:NREP 1 HM:PFM:REP 129->186|PF00561|4.1e-06|32.8|58/231|Abhydrolase_1| RP:SCP:NREP 1 RP:SCP:REP 1->193|1imjA|2e-37|31.6|190/208|c.69.1.23| HM:SCP:REP 4->192|1a8sA_|9.7e-36|37.6|186/0|c.69.1.12|1/1|alpha/beta-Hydrolases| OP:NHOMO 129 OP:NHOMOORG 82 OP:PATTERN ----1-1111111111-111111--------------------------------------111--1- ---------------1----------------2111------1---------------------11----------------------------------------------------------------------------------1---------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------212112-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------- ------1--------------------------------------------------------------------------------------------------------111112---112146-22662-434-11-2213---11-2-121-222212-2-------11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 193 STR:RPRED 99.5 SQ:SECSTR cEEEEEEETTEEEEEEEccccEEEEEEccTTccGGGGGGTHHHHHHTTTEEEEEEccTTcTTccccTTTccTTccHHHHHHHHHHHHHHTTcccEEEEEETHHHHHHHHHcGGGEEEEEEEcccccGGGHHHTTccccEEEEEETTcTTTTHHHHHHHcTTcEEEEETTccccHHHHcHHHHHHHHHHHHHTc# PSIPRED cccEEEEEccEEEEEEEcccccEEEEEccccccHHHHHHcccHHHHHcccEEEEEccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHcccccEEEEEEEcccccccccHHHHcccccEEEEEEcccccccHHHHHHHHHcccEEEEcccccccHHHcHHHHHHHHHHHHHHcc //