[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64561.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->51 PF07332 * DUF1469 0.00012 27.7 47/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64561.1 GT:GENE AAL64561.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1755965..1756171) GB:FROM 1755965 GB:TO 1756171 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64561.1 GB:DB_XREF GI:18161266 LENGTH 68 SQ:AASEQ MKLAIGLLLNLLAFILAALGYVVIAVAVYAASVILLAWPRKREEKKIEPPREPTPDEIKKRPVTAPEV GT:EXON 1|1-68:0| TM:NTM 1 TM:REGION 10->32| SEG 3->37|laiglllnllafilaalgyvviavavyaasvilla| SEG 39->53|prkreekkiepprep| HM:PFM:NREP 1 HM:PFM:REP 5->51|PF07332|0.00012|27.7|47/121|DUF1469| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 40-59, 64-68| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHccccccccc //