[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64566.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:202 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64566.1 GT:GENE AAL64566.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1759755..1760363 GB:FROM 1759755 GB:TO 1760363 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64566.1 GB:DB_XREF GI:18161271 LENGTH 202 SQ:AASEQ MQRYIMTSLALYAASFAAGIAGVSLLSALLSIGALFLIAVFLMKAHSLLIALKDKFWDKLSGVWLGGEYSAALWLFLLSGIGSEALLAIISSQFESIAALFPIDAAQGEVISQEVLNKAFALAALSLGLAALAAVGLAAWAYLIEVFTRDVYLIKVATGVGEFRPYSATFYILLSLITLGFLYYFWLYSLWRWISQLTSSTK GT:EXON 1|1-202:0| TM:NTM 5 TM:REGION 4->26| TM:REGION 32->53| TM:REGION 77->99| TM:REGION 116->138| TM:REGION 165->187| SEG 17->39|aagiagvsllsallsigalflia| SEG 119->143|afalaalslglaalaavglaawayl| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN ------------------1-111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 199-202| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //