[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64572.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:45 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->39 PF09560 * Spore_YunB 7.6e-05 35.5 31/94  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64572.1 GT:GENE AAL64572.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1762777..1762914) GB:FROM 1762777 GB:TO 1762914 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64572.1 GB:DB_XREF GI:18161277 LENGTH 45 SQ:AASEQ MRYLQKRKVAELPLDSAIKEVLLKVLGPEEEVYVERIGDRIRVIL GT:EXON 1|1-45:0| HM:PFM:NREP 1 HM:PFM:REP 9->39|PF09560|7.6e-05|35.5|31/94|Spore_YunB| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN ------------------1-111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED ccccHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHEEcc //