[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64620.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.107.1
:316 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   33->287 3dmaA PDBj 2e-11 12.4 %
:HMM:SCOP  13->292 1k20A_ c.107.1.1 * 2.6e-09 26.1 %
:HMM:PFM   250->272 PF02272 * DHHA1 6.6e-07 56.5 23/68  
:BLT:SWISS 205->279 RL3_VIBHB 7e-04 32.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64620.1 GT:GENE AAL64620.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1802425..1803375) GB:FROM 1802425 GB:TO 1803375 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64620.1 GB:DB_XREF GI:18161329 LENGTH 316 SQ:AASEQ MIALRALLAKLRGRPIALCDVGDVDGLASAALFKKRHPEGVVILVGPSDVKKWWVRAFTWDFVADLPCPGKAKVRADHHVTNKPCAEAEYYDPNAPAAAVLAAKALGLENDAVAKELVEAAVQTDTANITDQRVRLLDLAVRYAGRGEKYAIVDLLAVRGLAALEEGPLKKLAERGIERHNFLLKIAELLPLEESLFIYSPVRLGISYRMLTIELEKRGVQFVNILVRRGYRTYRLYCGAHKEGRYNCAEIASKMGGGGHKFAAGAVIKAPIYNVTKPIYALAELLKPNVVYVLGKCDNIKLPCREVPVMSRGSGD GT:EXON 1|1-316:0| BL:SWS:NREP 1 BL:SWS:REP 205->279|RL3_VIBHB|7e-04|32.0|75/100| SEG 3->14|alrallaklrgr| SEG 95->108|apaaavlaakalgl| RP:PDB:NREP 1 RP:PDB:REP 33->287|3dmaA|2e-11|12.4|251/329| HM:PFM:NREP 1 HM:PFM:REP 250->272|PF02272|6.6e-07|56.5|23/68|DHHA1| HM:SCP:REP 13->292|1k20A_|2.6e-09|26.1|253/310|c.107.1.1|1/1|DHH phosphoesterases| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN ----------------1111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 265 STR:RPRED 83.9 SQ:SECSTR ######################cHHHHHHHHHGcEETTTcHHHHHHHHHccEEEEccGGGGTTHHHHHHcccEEEEEccccccccccEEEEcTTcccHHHHHHHHHHHTcGGGccHHHHHHHHHHHHTTTTTcccccHHHHHHHHHHHTTTccHHHHHHHHHccccHHHHHHHHHcHHTEEETTTTEEEEEEcHHHHHHTTccTTTTTTGGGGGGGcTTccEEEEEEEcccEEEEEEEEEEcccccHHHHHHHHTccEEcccEEEEEEcccHHHHHHHHHHHHHcHH############################# DISOP:02AL 1-2, 312-316| PSIPRED cHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHccccEEEEEEcccccEEEEEHHHHHHHHcccccccEEEEEEEcccccccEEEEEEccccHHHHHHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHcccHHHHHHHHHccccccEEEEEEEEEEEccccEEEEEEEEEEccccEEEEEEEcccccccHHHHHHHcccccccccccEEEEccHHHHHHHHHHHHHHHcccEEEEEEccccccccHHHcccccccccc //