[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64674.1
DDBJ      :             ribosomal protein L11
Swiss-Prot:RL11_PYRAE   RecName: Full=50S ribosomal protein L11P;

Homologs  Archaea  65/68 : Bacteria  23/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.7
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->139 2jl6K PDBj 3e-11 27.6 %
:RPS:PDB   4->138 3bboK PDBj 4e-22 26.9 %
:RPS:SCOP  71->138 1hc8A  a.4.7.1 * 5e-15 26.5 %
:HMM:SCOP  65->138 1hc8A_ a.4.7.1 * 1.2e-16 35.1 %
:RPS:PFM   71->137 PF00298 * Ribosomal_L11 7e-07 38.8 %
:HMM:PFM   71->137 PF00298 * Ribosomal_L11 2.1e-19 35.8 67/69  
:BLT:SWISS 1->167 RL11_PYRAE 6e-92 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64674.1 GT:GENE AAL64674.1 GT:PRODUCT ribosomal protein L11 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1845793..1846296 GB:FROM 1845793 GB:TO 1846296 GB:DIRECTION + GB:PRODUCT ribosomal protein L11 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL64674.1 GB:DB_XREF GI:18161387 LENGTH 167 SQ:AASEQ MSKRVVTVPLQGGKVAVNPQFQDALKQIGLDPNAVVQRVQEELKKVGKYPVQKVEVEVVSPSKYEVKIYLPPIGDLLLKLFGKDTGAHDARNEVIGNLSFAQLVEIALLKKDELKSKTLKSAVKQLLSTCKAMGVTVDGRKAEEVLRDVDGGKYDEIINKFEKQWQQ GT:EXON 1|1-167:0| SW:ID RL11_PYRAE SW:DE RecName: Full=50S ribosomal protein L11P; SW:GN Name=rpl11p; OrderedLocusNames=PAE3104; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->167|RL11_PYRAE|6e-92|100.0|167/167| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 5->139|2jl6K|3e-11|27.6|134/140| RP:PDB:NREP 1 RP:PDB:REP 4->138|3bboK|4e-22|26.9|134/145| RP:PFM:NREP 1 RP:PFM:REP 71->137|PF00298|7e-07|38.8|67/69|Ribosomal_L11| HM:PFM:NREP 1 HM:PFM:REP 71->137|PF00298|2.1e-19|35.8|67/69|Ribosomal_L11| GO:PFM:NREP 3 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00298|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF00298|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF00298|IPR000911| RP:SCP:NREP 1 RP:SCP:REP 71->138|1hc8A|5e-15|26.5|68/74|a.4.7.1| HM:SCP:REP 65->138|1hc8A_|1.2e-16|35.1|74/0|a.4.7.1|1/1|Ribosomal protein L11, C-terminal domain| OP:NHOMO 97 OP:NHOMOORG 92 OP:PATTERN 111111111111111111111111111111--1111111111111111111111111111111111-1 -----------------------------------------------------------------------------------1----------------------------------------------------1111-----1-------------------------1----11----1---11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- --------------------------------------------------------------------------------------3---2-------------------------------------------------------------------------------2--------------------1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 83.2 SQ:SECSTR ccccEEEEcccTTcccccTTTTTTTTTTcccTTccHHHHHHHGGGcccccccEEEEEEcccccEEEEEccccTTHHHHHHHTcccccccTTTcccEEEcHHHHHHHHHHTcTTcccccHHHHHHHHHHHHTTTTEEEcc############################ DISOP:02AL 82-94, 164-167| PSIPRED cccEEEEEEEEcccccccccccHHHccccccHHHHHHHHHHHHHHHccccccEEEEEEEcccEEEEEEEEccHHHHHHHHHccccccccccccEEEEccHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccEEEccccHHHHHHHcccHHHHHHHHHHHccccc //