[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64680.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:78 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   44->58 PF08139 * LPAM_1 0.00084 40.0 15/26  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64680.1 GT:GENE AAL64680.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1850001..1850237 GB:FROM 1850001 GB:TO 1850237 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64680.1 GB:DB_XREF GI:18161393 LENGTH 78 SQ:AASEQ MIVKLIYIRDVAIIKLGLDPCADVFTFKISGREIVICGKTLILSDSLEKFKKGLLILGTTPYFVECENGECIAARAQI GT:EXON 1|1-78:0| TM:NTM 1 TM:REGION 1->23| HM:PFM:NREP 1 HM:PFM:REP 44->58|PF08139|0.00084|40.0|15/26|LPAM_1| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,31-31,39-39,45-45,48-48,53-54,59-60,62-62| PSIPRED cEEEEEEEEEEEEEEEEcccccEEEEEEEcccEEEEEccEEEEEHHHHHHHccEEEEEcccEEEEEccccEEEEEEcc //