[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64696.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  32/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->97 2gmgA PDBj 2e-13 39.6 %
:RPS:SCOP  2->97 2gmgA1  a.4.5.82 * 6e-14 39.1 %
:HMM:PFM   62->87 PF09723 * CxxC_CxxC_SSSS 7.3e-06 38.5 26/42  
:BLT:SWISS 10->45 LEU1_THETH 4e-04 41.7 %
:BLT:SWISS 62->99 RGYR_ARCFU 8e-04 50.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64696.1 GT:GENE AAL64696.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1864890..1865189 GB:FROM 1864890 GB:TO 1865189 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64696.1 GB:DB_XREF GI:18161411 LENGTH 99 SQ:AASEQ METVRERLIKVLLESREPLTVNQLQALVNTELKPSELYDELEHVKKTLKRMGYRLELVPAVCKNCGYEFRDREKLKKPSRCPRCKSERIEPPKFYIEPL GT:EXON 1|1-99:0| BL:SWS:NREP 2 BL:SWS:REP 10->45|LEU1_THETH|4e-04|41.7|36/331| BL:SWS:REP 62->99|RGYR_ARCFU|8e-04|50.0|32/1054| BL:PDB:NREP 1 BL:PDB:REP 3->97|2gmgA|2e-13|39.6|91/105| HM:PFM:NREP 1 HM:PFM:REP 62->87|PF09723|7.3e-06|38.5|26/42|CxxC_CxxC_SSSS| RP:SCP:NREP 1 RP:SCP:REP 2->97|2gmgA1|6e-14|39.1|92/105|a.4.5.82| OP:NHOMO 42 OP:NHOMOORG 42 OP:PATTERN --1111111111111-1-111111---1111----------------------111-1111---1--- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111-----1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 91.9 SQ:SECSTR ##HHHHHHHHHTTTc##cccTTHHHHcccccccccHHHHHHHHHHHHHTTTTEEEEEcccccTTTccccc##cccccccccccccccccccccEEEE## DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccEEEEEcccccccccEEcccccccccccccccccccccccHHHcccc //