[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64699.1
DDBJ      :             ribosomal protein L14
Swiss-Prot:RL14_PYRAE   RecName: Full=50S ribosomal protein L14P;

Homologs  Archaea  68/68 : Bacteria  585/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
b.39.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->144 1s72K PDBj 4e-30 49.6 %
:RPS:PDB   22->144 3bboM PDBj 2e-31 35.0 %
:RPS:SCOP  15->144 1s72K  b.39.1.1 * 6e-36 46.1 %
:HMM:SCOP  11->144 1ffkH_ b.39.1.1 * 1.1e-42 41.7 %
:RPS:PFM   30->128 PF00238 * Ribosomal_L14 3e-14 46.2 %
:HMM:PFM   22->144 PF00238 * Ribosomal_L14 1.7e-38 42.7 117/122  
:BLT:SWISS 1->144 RL14_PYRAE 2e-78 100.0 %
:PROS 83->109|PS00049|RIBOSOMAL_L14
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64699.1 GT:GENE AAL64699.1 GT:PRODUCT ribosomal protein L14 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1867554..1867988 GB:FROM 1867554 GB:TO 1867988 GB:DIRECTION + GB:PRODUCT ribosomal protein L14 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL64699.1 GB:DB_XREF GI:18161414 LENGTH 144 SQ:AASEQ MAKRGGKRTVGVPYRFHVTPGIFMNSLVPVADNSGAKLVRVIGVVGHYSKTVHRRIPGAGVGDMVVVVVREGKPELRKQIFRAIVVRQRRPYRRPDGTWVAFEDNAVVIVTPEGDPKGSEIHGPVAMEATLRWPTIANLASIVV GT:EXON 1|1-144:0| SW:ID RL14_PYRAE SW:DE RecName: Full=50S ribosomal protein L14P; SW:GN Name=rpl14p; OrderedLocusNames=PAE3136; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->144|RL14_PYRAE|2e-78|100.0|144/144| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 83->109|PS00049|RIBOSOMAL_L14|PDOC00048| SEG 65->69|vvvvv| BL:PDB:NREP 1 BL:PDB:REP 18->144|1s72K|4e-30|49.6|125/132| RP:PDB:NREP 1 RP:PDB:REP 22->144|3bboM|2e-31|35.0|117/121| RP:PFM:NREP 1 RP:PFM:REP 30->128|PF00238|3e-14|46.2|93/122|Ribosomal_L14| HM:PFM:NREP 1 HM:PFM:REP 22->144|PF00238|1.7e-38|42.7|117/122|Ribosomal_L14| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00238|IPR000218| GO:PFM GO:0005622|"GO:intracellular"|PF00238|IPR000218| GO:PFM GO:0005840|"GO:ribosome"|PF00238|IPR000218| GO:PFM GO:0006412|"GO:translation"|PF00238|IPR000218| RP:SCP:NREP 1 RP:SCP:REP 15->144|1s72K|6e-36|46.1|128/132|b.39.1.1| HM:SCP:REP 11->144|1ffkH_|1.1e-42|41.7|132/132|b.39.1.1|1/1|Ribosomal protein L14| OP:NHOMO 975 OP:NHOMOORG 839 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111111 111-1111111111-------1---------------111----1--11111111-1111-----111111-------1----1----111-1111--1-1111111-1111111111111111---------11-1111111111-11111111-----1-1111-111-1--1111-11-1-----11---1---------------1----------------------1-------------------------------11-----1-111111--------------------------------------------1---------------1--------1-1---1------1-1-----1111-1-111121111111111111111111111111111-11111111111-1111111111111-1--11111111111111111111111111111----------------------111-11111-111111111111111111111111111111111111111111111111111-1111111-11111111111-11111111--1111---111-111111111111-1-----------------11--11111111--11111111111111111111-11-1--1111-11111111111111111111-11111111111111111111-111111-111111111111111111111111-111111111111--11-----11111111111-11-11111-11111111111111111111111111111111111111111111111111111-1111111111111111--1-1112111111111111-11111-11111111111111111111111111111111 111111114221222122112221121111111222111111122211212222112111-121211112122122222212222232-1222211111111122411212111111---121114-21371-214--111-11-11111--111111124112111113111112231H11111755B2331111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 130 STR:RPRED 90.3 SQ:SECSTR ##############cccEccccccccEEEEcccccEEEEEEEEEcccccccTTcccccccTTcEEEEEEEEEcccccccEEEEEEEEccccEEcTTccEEcccccEEEEccTTcccccccccccccGGGTTTcHHHHHHccccc DISOP:02AL 1-14| PSIPRED ccccccccccccccEEEEEcccccccEEEEEEccccEEEEEEEEEcccccEEEEEccccccccEEEEEEEcccccccccEEEEEEEEcccccccccccEEEEcccEEEEEcccccEEEEEEEcccHHHHHHHHHHHHHHccccc //