[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64710.1
DDBJ      :             thiol:disulphide interchange protein, putative
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:166 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->156 3gv1A PDBj 1e-09 35.8 %
:RPS:PDB   32->166 3dvxA PDBj 1e-07 14.6 %
:RPS:SCOP  28->158 1z6mA1  c.47.1.13 * 5e-15 25.2 %
:HMM:SCOP  9->167 1t3bA1 c.47.1.9 * 1.8e-17 29.1 %
:HMM:PFM   118->156 PF01323 * DSBA 0.00036 35.3 34/193  
:HMM:PFM   34->72 PF00578 * AhpC-TSA 0.00043 23.1 39/124  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64710.1 GT:GENE AAL64710.1 GT:PRODUCT thiol:disulphide interchange protein, putative GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1876042..1876542) GB:FROM 1876042 GB:TO 1876542 GB:DIRECTION - GB:PRODUCT thiol:disulphide interchange protein, putative GB:NOTE Protein fate; Protein modification and repair GB:PROTEIN_ID AAL64710.1 GB:DB_XREF GI:18161426 LENGTH 166 SQ:AASEQ MIFKRQKPRLTPITKTDVVKRLLDLAVVKVGNSDKAVLVFFDLKCPFCARLFKETEEILVDMAKRGLVTFAMCDYVVHKEAEPLHRKLRCLSEEERLKLISDVYSGKRVDAGECPEGNLRECEKAAEEVGVYGTPTILFYNFAKGRGYIHFGYMPPSDVLDAISSL GT:EXON 1|1-166:0| BL:PDB:NREP 1 BL:PDB:REP 23->156|3gv1A|1e-09|35.8|120/134| RP:PDB:NREP 1 RP:PDB:REP 32->166|3dvxA|1e-07|14.6|130/187| HM:PFM:NREP 2 HM:PFM:REP 118->156|PF01323|0.00036|35.3|34/193|DSBA| HM:PFM:REP 34->72|PF00578|0.00043|23.1|39/124|AhpC-TSA| RP:SCP:NREP 1 RP:SCP:REP 28->158|1z6mA1|5e-15|25.2|123/172|c.47.1.13| HM:SCP:REP 9->167|1t3bA1|1.8e-17|29.1|148/150|c.47.1.9|1/1|Thioredoxin-like| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN ----------------1111111--------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 93.4 SQ:SECSTR ###########cccccccHHHHHHTTTcccTTTcEEEEEEEcTTcHHHHHHHHHHHHHHHHccTTEEEEEEEccccGGHHHHHHHHHHHHHHTTcccTTcHHHHHHHHHHcccccHHHHHHHHHHHHHHTcccccEEEETTTEETTTEEEccTTHHHHHHHHHHHH DISOP:02AL 3-7| PSIPRED cccccccccccccccccHHHcccccccEEcccccEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccEEEEccccEEccEEEEccccHHHHHHHHHcc //