[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64734.1
DDBJ      :             pyruvate formate-lyase activating enzyme homolog
Swiss-Prot:             

Homologs  Archaea  61/68 : Bacteria  138/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:363 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   74->283 3cb8A PDBj 1e-08 28.3 %
:RPS:PDB   55->352 3ciwA PDBj 9e-18 13.3 %
:RPS:SCOP  78->309 1tv7A  c.1.28.3 * 1e-15 23.1 %
:HMM:SCOP  34->315 1r30A_ c.1.28.1 * 3.7e-35 24.6 %
:RPS:PFM   78->232 PF04055 * Radical_SAM 2e-04 28.1 %
:HMM:PFM   78->231 PF04055 * Radical_SAM 5.3e-18 25.7 152/166  
:HMM:PFM   296->334 PF08271 * TF_Zn_Ribbon 0.00019 31.0 29/43  
:BLT:SWISS 2->335 Y808_METJA 4e-83 47.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64734.1 GT:GENE AAL64734.1 GT:PRODUCT pyruvate formate-lyase activating enzyme homolog GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1897479..1898570 GB:FROM 1897479 GB:TO 1898570 GB:DIRECTION + GB:PRODUCT pyruvate formate-lyase activating enzyme homolog GB:NOTE Protein fate; Protein modification and repair GB:PROTEIN_ID AAL64734.1 GB:DB_XREF GI:18161452 LENGTH 363 SQ:AASEQ MEAVLSRALPDGRVECTACARRCKLREGQTGFCGVRTVRGGRLVLDVYGLISAIAIDPIEKKPLTHFYPGALVLSFSTFGCNWACQYCQNFEISQRRRAEGFEVTPELLVKMAESYGAHGITYTYNEPTIFMEFAHDVGVLAKSKGLFNTFVTNGYMTPEAVKYASEFLDAATVDFKGNADEKFMRKYIYVPDAEPIFETLAEMKRYGIWVEVTDLVVPKVGDDLEKARRLVRRVIDIVGPDVPIHFLRFHPDYKMMDLPPTPVETLEKHVEVAKKEGARFAYVGNVPGHRYEHTYCPECGRVVIKRRGFDILEINLVEKGGEYRCKFCGAKIPIKGKIMPTWRDEFRFVYVPIQTFARWVRR GT:EXON 1|1-363:0| BL:SWS:NREP 1 BL:SWS:REP 2->335|Y808_METJA|4e-83|47.5|326/333| BL:PDB:NREP 1 BL:PDB:REP 74->283|3cb8A|1e-08|28.3|205/244| RP:PDB:NREP 1 RP:PDB:REP 55->352|3ciwA|9e-18|13.3|293/344| RP:PFM:NREP 1 RP:PFM:REP 78->232|PF04055|2e-04|28.1|153/164|Radical_SAM| HM:PFM:NREP 2 HM:PFM:REP 78->231|PF04055|5.3e-18|25.7|152/166|Radical_SAM| HM:PFM:REP 296->334|PF08271|0.00019|31.0|29/43|TF_Zn_Ribbon| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 1 RP:SCP:REP 78->309|1tv7A|1e-15|23.1|225/327|c.1.28.3| HM:SCP:REP 34->315|1r30A_|3.7e-35|24.6|272/312|c.1.28.1|1/1|Radical SAM enzymes| OP:NHOMO 260 OP:NHOMOORG 201 OP:PATTERN 111122111111111122224323-----1--111111212112212322432313211221112111 -1---------------11-1-----11111----------------------------------------------11-11-11111-------------------------------------11-------1-111221111-----------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------21-1-------------11-111--1-----1111111223111-2211--1----------------------------------------1----------------------------------------------1-1-----------------------------------------------------------------11--------------1----11---------------111-212-111121111-1111111341121-112--------------------1-12211--1-------1-------1----1-1--11-----11--------------------------------------------------------------------------------------------------11111-1----------------------------------------------------------11--------11----------------1---------------1---------------------------1111111111-1- -----------1-------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 302 STR:RPRED 83.2 SQ:SECSTR ##################################################ccccHHHHHHHHHHccEEEEEEEEEEEEcccccccTTcTTcTTccccccccccHHHHHHHHHHHHTTccEEEEEEcccGGTTHHHHHHHHHHHTTTcEEEEEcccccHHHHHHHHHTTccEEEccccccHcHHHHHHHcTTccHHHHHHHHHHHHTTcEEEEccEEccTTTTccHHHHHHHHHHHHHHTccEEccEEccccTTcTTTTcccccHHHHHHHHHHHHHHcTTcccHHHHHHcTTHHHHHHTTTccEETccccccTTTGGGccccTTcTTTTccTTcHHHHHEEccccccccccc########### PSIPRED cccEEEEEcccccEEEEEEcHHcEEccccEEEcccEEEcccEEEEcccccEEEEcccccccccccccccccEEEEEEEccccccccccccHHHccccccccccccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHccccEEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccHHHHHHHHHHHHHccccEEEEccccccccccccccccccEEEEEEcccEEEEEEcccccccccccccccccEEEEcccccccccEEEEEEHHHHHHHHcc //