[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64752.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:218 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64752.1 GT:GENE AAL64752.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1917475..1918131 GB:FROM 1917475 GB:TO 1918131 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64752.1 GB:DB_XREF GI:18161471 LENGTH 218 SQ:AASEQ MAQRRGLFRIVTPKGWAVLPPGAEAVLWPPVDLPKARALDLAEHRALLPISISVVKVLAEPGRNMYLLKAGRTYMLSASRTAKSSTPPAGVTHELRLFCGGPCDLSPLYFLSLPRGATAVVRGFIDVEPAGRWALAPPPPEGDPKGGLDILADPQRAKALLALVYDKSKETRKLACDLGLWTPCPGEGPGRFTTAALHALRLIAHFLPDRTEAAEDEG GT:EXON 1|1-218:0| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN ------------------12-11--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 80-88, 211-218| PSIPRED cccccccEEEEcccccEEEcccccEEEEcccccccHHHHHHHHccEEccHHHHHHHHHHcccccEEEEEcccEEEEEcccccccccccccccEEEEEEEccccccccEEEEEccccHHHHHEEEEEEccccccccccccccccccccccEEEccHHHHHEEHHEEcccccHHEEEEEccccccccccccccHHHHHHHHHHHHHHHcccccccccccc //