[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64791.1
DDBJ      :             ribosomal protein L40
Swiss-Prot:RL40_PYRAE   RecName: Full=50S ribosomal protein L40e;

Homologs  Archaea  22/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:53 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->49 2ayjA PDBj 7e-12 60.4 %
:RPS:SCOP  1->48 2ayjA1  g.41.8.7 * 2e-08 61.7 %
:HMM:PFM   6->49 PF01020 * Ribosomal_L40e 1.3e-07 40.9 44/52  
:BLT:SWISS 1->53 RL40_PYRAE 4e-29 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64791.1 GT:GENE AAL64791.1 GT:PRODUCT ribosomal protein L40 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1951510..1951671 GB:FROM 1951510 GB:TO 1951671 GB:DIRECTION + GB:PRODUCT ribosomal protein L40 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL64791.1 GB:DB_XREF GI:18161513 LENGTH 53 SQ:AASEQ MPITLDPEKLAIVMKHRFQYKICRECGAKNPPDAVKCRRCRSRNLRPKRFRKK GT:EXON 1|1-53:0| SW:ID RL40_PYRAE SW:DE RecName: Full=50S ribosomal protein L40e; SW:GN Name=rpl40e; OrderedLocusNames=PAE3255; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->53|RL40_PYRAE|4e-29|100.0|53/53| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 1->49|2ayjA|7e-12|60.4|48/56| HM:PFM:NREP 1 HM:PFM:REP 6->49|PF01020|1.3e-07|40.9|44/52|Ribosomal_L40e| RP:SCP:NREP 1 RP:SCP:REP 1->48|2ayjA1|2e-08|61.7|47/56|g.41.8.7| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN 11-111-1111111111111111-----------------------------------------1--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 48 STR:RPRED 90.6 SQ:SECSTR cccc#ccccccTTTTcccccEEETTTccEEcTTccccTTTccccEEEcc#### DISOP:02AL 1-2, 48-53| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc //