[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64809.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  96/915 : Eukaryota  64/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:235 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   31->210 1y44A PDBj 9e-14 33.1 %
:RPS:PDB   1->211 2cbnA PDBj 3e-14 27.0 %
:RPS:SCOP  5->211 1zkpA1  d.157.1.9 * 2e-32 27.0 %
:HMM:SCOP  1->214 2cbnA1 d.157.1.7 * 2.2e-50 31.3 %
:RPS:PFM   132->207 PF01073 * 3Beta_HSD 1e-04 32.9 %
:HMM:PFM   25->206 PF00753 * Lactamase_B 2.9e-10 18.0 172/194  
:BLT:SWISS 2->219 RNZ2_HUMAN 2e-16 32.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64809.1 GT:GENE AAL64809.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1969170..1969877 GB:FROM 1969170 GB:TO 1969877 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64809.1 GB:DB_XREF GI:18161533 LENGTH 235 SQ:AASEQ MEIYVIGYGGWISNPLLGYPSLYIKTDINVLIDAGECTFAKMATCHLPWPDVVFISHKHGDHILGLPTFMLMARRLGKRIKIVANKETLEAARALALITGIENALQHVEFIEAENALRIGETSFAFAATAHPVPTLAIRVEHGGKCVTYSSDTSPSDKLIELARGCDLLIHEASGNPGQEEEAHKVGHSTTADAVNIALKAGVKMLMPIHFYLEPPVVPQGVTIVIPTPCGKIVV GT:EXON 1|1-235:0| BL:SWS:NREP 1 BL:SWS:REP 2->219|RNZ2_HUMAN|2e-16|32.4|216/826| BL:PDB:NREP 1 BL:PDB:REP 31->210|1y44A|9e-14|33.1|178/265| RP:PDB:NREP 1 RP:PDB:REP 1->211|2cbnA|3e-14|27.0|211/306| RP:PFM:NREP 1 RP:PFM:REP 132->207|PF01073|1e-04|32.9|76/261|3Beta_HSD| HM:PFM:NREP 1 HM:PFM:REP 25->206|PF00753|2.9e-10|18.0|172/194|Lactamase_B| GO:PFM:NREP 2 GO:PFM GO:0003854|"GO:3-beta-hydroxy-delta5-steroid dehydrogenase activity"|PF01073|IPR002225| GO:PFM GO:0006694|"GO:steroid biosynthetic process"|PF01073|IPR002225| RP:SCP:NREP 1 RP:SCP:REP 5->211|1zkpA1|2e-32|27.0|200/244|d.157.1.9| HM:SCP:REP 1->214|2cbnA1|2.2e-50|31.3|214/0|d.157.1.7|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 218 OP:NHOMOORG 179 OP:PATTERN --1111----------1111111-----------1--------1---1-11------1---2--1--- ----11--111-1-1----------------------1-----1----------------12-----11-1-----------------------------------------------------------------11111------------------1----------1---------------------11111111111111111-1--11111111-1--11111111-------------------------------------1-1-------------111------------1111-1-1111-----------11-1---------------1-----1----------11-------11-----------------1-----------------------------------------------1---------------------------1------------------------------------------------------------------------------------------------------------1-1-----------1111--1--1--1-112-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---- ----21--1-------------------------------------11---------------------------------------1--21-1-111---111111-------1--11-11--311115H1-11-1-1-1-111----13--311-111---21111---1211-1--511-1-------1--11--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 217 STR:RPRED 92.3 SQ:SECSTR cEEEEEEcccccccccccccEcccccccEEEEcccTTHHHHHHTccTTTEEEEEcccccHHHHTTHHHHHHHHTTccccEEEEEcTTHHHHHHHHHHHTTcccccEEEEEcccEEEEEcccEEEEEEEcccccccEEEEEEEcccEEEEccccccccTHHHHHTTccEEEEEccccGGGHHHHHHTTcccHHHHHHHHHHHTccEEEEEccTHHHTT################## PSIPRED cEEEEEEccccccccccccEEEEEEccEEEEEEccHHHHHHHHHcccccEEEEEEEcccHHHHccHHHHHHHHHHcccccEEEEcHHHHHHHHHHHHccccccccEEEEEEcccccEEEccEEEEEEEcccccccEEEEEEcccEEEEEEccccccHHHHHHHccccEEEEccccccccHHHHcccccccHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHccccccEEcc //