[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64810.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y3284_PYRAE  RecName: Full=UPF0218 protein PAE3284;

Homologs  Archaea  32/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   29->102 3fi9B PDBj 4e-04 35.6 %
:RPS:PFM   23->112 PF04019 * DUF359 4e-14 44.4 %
:HMM:PFM   23->139 PF04019 * DUF359 6.8e-37 45.3 117/121  
:BLT:SWISS 1->140 Y3284_PYRAE 4e-78 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64810.1 GT:GENE AAL64810.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1969958..1970380 GB:FROM 1969958 GB:TO 1970380 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64810.1 GB:DB_XREF GI:18161534 LENGTH 140 SQ:AASEQ MEVVKDIAESYGAERIYTVGDVVTQNFFKHGLIPTSAAVDEKTRRGVRIEQLAVFKRVIKVNNPPGYITEEAWSAVEEAVRGGVIIKVEGEEDMLSLAFIKLAPPKSIVAYGHYLGALIALPVDWYKEYVLKLFDYLEKC GT:EXON 1|1-140:0| SW:ID Y3284_PYRAE SW:DE RecName: Full=UPF0218 protein PAE3284; SW:GN OrderedLocusNames=PAE3284; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->140|Y3284_PYRAE|4e-78|100.0|140/140| TM:NTM 1 TM:REGION 114->136| BL:PDB:NREP 1 BL:PDB:REP 29->102|3fi9B|4e-04|35.6|73/320| RP:PFM:NREP 1 RP:PFM:REP 23->112|PF04019|4e-14|44.4|90/120|DUF359| HM:PFM:NREP 1 HM:PFM:REP 23->139|PF04019|6.8e-37|45.3|117/121|DUF359| OP:NHOMO 32 OP:NHOMOORG 32 OP:PATTERN ---1---1---------1111111--------1-1111111111-1111-1-111111--1------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 52.1 SQ:SECSTR ############################HHHTccGGGEEcccEEEc#cGGGEEEcGGGcEETTEETTccHHHHHHHHHHHTHHHHHHHHcccccHHHHHHHH###################################### PSIPRED cHHHHHHHHHccccEEEEEcHHHHHHHHHcccccEEEEEEccHHccccccccEEccEEEEEEccccEEcHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHcccccEEEEEEcccEEEEEEccHHHHHHHHHHHHHHcc //