[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64825.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:166 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->67 PF05890 * Ebp2 0.00018 36.5 52/271  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64825.1 GT:GENE AAL64825.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1979774..1980274 GB:FROM 1979774 GB:TO 1980274 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64825.1 GB:DB_XREF GI:18161550 LENGTH 166 SQ:AASEQ MFSKIKLGIEEWKKLEADLERISSGAPLELIINLTLVASGGEEEEEEEEHHHNHVHEIDNDFTREVAKLIDYIAHTYNAHVHPHVHANHGSVMFAVKGAPKDLLKALREVLDFVKLNCEKCLLHSLDGEFHLGEDLSGIYFGDSYKITVIVPAEDGKRLKVHEVHF GT:EXON 1|1-166:0| SEG 42->57|eeeeeeeehhhnhvhe| SEG 78->89|nahvhphvhanh| HM:PFM:NREP 1 HM:PFM:REP 6->67|PF05890|0.00018|36.5|52/271|Ebp2| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 39-53| PSIPRED cccHHHccHHHHHHHHHHHHHHcccccEEEEEEEEEEEccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEcccccEEEEEccccHHHHHHHHHHHHHHHccHHHHHHHHccccEEEcccccEEEEcccEEEEEEEEcccccEEEEEEccc //