[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64830.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64830.1 GT:GENE AAL64830.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1983707..1984135) GB:FROM 1983707 GB:TO 1984135 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64830.1 GB:DB_XREF GI:18161556 LENGTH 142 SQ:AASEQ MRIERTGNPVSKLLQLLEEDLKRDDIIQIERVPAPKPSVKYREVVSKFLKEFGLATVYIRIRSAAFERRYVISAKYDWTMGGVVEGWVVEGDVVRIFEPIAISLTDMEKALDYYGDAFWKAEEKLLSKKMTEAYQEEKPPAD GT:EXON 1|1-142:0| SEG 81->94|ggvvegwvvegdvv| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 130-142| PSIPRED ccccccccHHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHEEEEEEccccccccEEEcEEEcccHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //