[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64835.1
DDBJ      :             D-3-phosphoglycerate dehydrogenase (serA)
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  789/915 : Eukaryota  188/199 : Viruses  1/175   --->[See Alignment]
c.2.1c.23.12c.91.1
:307 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   48->283 1wwkB PDBj 2e-65 54.1 %
:RPS:PDB   1->303 3ba1A PDBj 8e-61 30.3 %
:RPS:SCOP  48->284 1aq2A1  c.91.1.1 * 2e-39 9.4 %
:HMM:SCOP  1->135 1ygyA2 c.23.12.1 * 1.1e-33 38.8 %
:HMM:SCOP  98->281 2nacA1 c.2.1.4 * 1.9e-54 47.0 %
:RPS:PFM   105->279 PF02826 * 2-Hacid_dh_C 1e-40 50.0 %
:HMM:PFM   105->280 PF02826 * 2-Hacid_dh_C 2.9e-58 45.4 174/178  
:BLT:SWISS 4->303 SERA_METJA 6e-59 40.3 %
:PROS 190->212|PS00670|D_2_HYDROXYACID_DH_2
:PROS 219->235|PS00671|D_2_HYDROXYACID_DH_3
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64835.1 GT:GENE AAL64835.1 GT:PRODUCT D-3-phosphoglycerate dehydrogenase (serA) GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1987908..1988831 GB:FROM 1987908 GB:TO 1988831 GB:DIRECTION + GB:PRODUCT D-3-phosphoglycerate dehydrogenase (serA) GB:NOTE Amino acid biosynthesis; Serine family GB:PROTEIN_ID AAL64835.1 GB:DB_XREF GI:18161561 LENGTH 307 SQ:AASEQ MSALIVDKVDETLKERLERIGIKVDLAPGISKDDLIKIIKNYNILIFRGRLKIDKDIMDAGQNLKILARYGVGLDNVDVEYAVKKGIAVVSAPNAPSQSVAELTIGLLFSVARRIPLLNAKVKAGEWPKGKYIGIEIAGKTMGIVGFGRIGRFVAQMAKSLGMNILASDVIDVSKEVAKIGGRQVPLEELLRQSDVVTIHVPLTPETYHLLNAERLSLLKDGAIIINTSRGEVIDHEALLKHLDRLWGVGLDVLPEEPPKSHYLRQLIAHEKVVVTPHVGSETKEAMMRLAEELAANIEEVIQRIKL GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 4->303|SERA_METJA|6e-59|40.3|295/524| PROS 190->212|PS00670|D_2_HYDROXYACID_DH_2|PDOC00063| PROS 219->235|PS00671|D_2_HYDROXYACID_DH_3|PDOC00063| SEG 33->46|ddlikiiknynili| SEG 285->296|eammrlaeelaa| BL:PDB:NREP 1 BL:PDB:REP 48->283|1wwkB|2e-65|54.1|233/302| RP:PDB:NREP 1 RP:PDB:REP 1->303|3ba1A|8e-61|30.3|297/312| RP:PFM:NREP 1 RP:PFM:REP 105->279|PF02826|1e-40|50.0|172/176|2-Hacid_dh_C| HM:PFM:NREP 1 HM:PFM:REP 105->280|PF02826|2.9e-58|45.4|174/178|2-Hacid_dh_C| GO:PFM:NREP 2 GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF02826|IPR006140| GO:PFM GO:0048037|"GO:cofactor binding"|PF02826|IPR006140| RP:SCP:NREP 1 RP:SCP:REP 48->284|1aq2A1|2e-39|9.4|224/310|c.91.1.1| HM:SCP:REP 1->135|1ygyA2|1.1e-33|38.8|129/0|c.23.12.1|1/1|Formate/glycerate dehydrogenase catalytic domain-like| HM:SCP:REP 98->281|2nacA1|1.9e-54|47.0|181/0|c.2.1.4|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4619 OP:NHOMOORG 1045 OP:PATTERN 33211142222222223323321252223361111111222212121112221233333333122-22 2371822233311145522-241148222224444423982413333111227A6323--43324675A713222333113232233344441433---33424444634-----------------1311--12-33355111232313443112211111123223342111111221122322334422233333333333333334354333332444712333334233777777777777778557632554447121554435-416972223331----11-----------1----111111-1211111111136167444444425323553222532113234167111122129942-332145334-1--167CCB3255979555555554557-6776765BCB41DEE5969BAABFB744134787898452222222255531333-----------------------------234723486597AA9A63444477CA666656C6C9CEA-466555687A5C49B54212--22112222244312133331--23112222222322346333323242222222222222222222222332226675743344455555465555445554551-12234------55654444555465634-54456554555644444447C856334555555555555555565543334216666666666661-3322222444324569222334-33233222334333623394666668AB566883766111113111334465555554666333333333411112213223433--------11-------1---2------11------3243324222232 ----373-31--3529BA79998CAB97766777776A89A8A888976BCFIH9AA66555E4622425435465526579989A33-8E6B684ABBA616554-374CA9A9A632-34426E2D4AX7-6692433942541333152254B58A45534734E58822853874t55459GAHL8A966HAGF7 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- STR:NPRED 303 STR:RPRED 98.7 SQ:SECSTR cEEEEcccccHHHHHHHHHcEEEEGGGcccHHHHHHHHTTTEEEEEEcccccccHHHHHHcTTccEEEEcccccTTccHHHHHHHTcEEEccccTTHHHHHHHHHHHHHHHHTTHHHHHHHHHTTGGGGccccccccTTccEEEEcccHHHHHHHHHHHTTTccEEEEccEcccccTTcccEEEccHHHHHHTccEEEEcccccGGGTTcccHHHHHHHcTTcEEEEcccGGGccHHHHHHHHHcccEEEEcccTTTTcccGGGGGGGGcTTEEEccccTTccHHHHHHHHHHHHHHHHHHHH#### PSIPRED cEEEEEccccHHHHHHHHHcccEEEEcccccHHHHHHHHccccEEEEcccccccHHHHHHccccEEEEEcccccccccHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEccccccHHHHHHccEEccHHHHHHHccEEEEcccccHHHHccccHHHHHHccccEEEEEccccccccHHHHHHHHHHHcEEEEcccccccccccHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHHHHHHcccc //