[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64838.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   13->56 1au1B PDBj 4e-04 29.3 %
:HMM:PFM   8->75 PF11353 * DUF3153 0.00069 16.4 67/209  
:BLT:SWISS 16->121 GRPE_KLULA 7e-04 29.5 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64838.1 GT:GENE AAL64838.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1990603..1991025) GB:FROM 1990603 GB:TO 1991025 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64838.1 GB:DB_XREF GI:18161564 LENGTH 140 SQ:AASEQ MDILTVKTYEDAQQFLSELDRQINDLEALVKAVGDELEKLKPSLERYKRLQDLLKKFSGEAGEKSAPIEITGLQLYIDPNPMVRHEILEESYKHMVDLLSVLKKVREVAQSVIKEGGLESLRIVVQFKNGVPVKLIVLGQ GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 16->121|GRPE_KLULA|7e-04|29.5|105/243| COIL:NAA 36 COIL:NSEG 1 COIL:REGION 6->41| RP:PDB:NREP 1 RP:PDB:REP 13->56|1au1B|4e-04|29.3|41/163| HM:PFM:NREP 1 HM:PFM:REP 8->75|PF11353|0.00069|16.4|67/209|DUF3153| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN ---1------------1111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 41 STR:RPRED 29.3 SQ:SECSTR ############HHHHHHHHHHHHHHHHHHH###HTTTcccccHHHHHHHHHHHHH#################################################################################### PSIPRED ccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEEEcc //