[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64843.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.43.3
:66 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->55 2hvyB PDBj 7e-04 34.5 %
:RPS:SCOP  1->55 2ey4C1  b.43.3.5 * 1e-09 34.5 %
:HMM:SCOP  2->56 2ey4C1 b.43.3.5 * 6.6e-07 38.2 %
:HMM:PFM   20->61 PF04410 * Gar1 4.7e-06 21.4 42/155  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64843.1 GT:GENE AAL64843.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1994267..1994467) GB:FROM 1994267 GB:TO 1994467 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64843.1 GB:DB_XREF GI:18161569 LENGTH 66 SQ:AASEQ MVRLFEVPPLYVNTYTYTMKIVGILYDVIGNIKNPYGLVKATSRDDSIIGQAIYVKPQELERKRRK GT:EXON 1|1-66:0| BL:PDB:NREP 1 BL:PDB:REP 1->55|2hvyB|7e-04|34.5|55/74| HM:PFM:NREP 1 HM:PFM:REP 20->61|PF04410|4.7e-06|21.4|42/155|Gar1| RP:SCP:NREP 1 RP:SCP:REP 1->55|2ey4C1|1e-09|34.5|55/73|b.43.3.5| HM:SCP:REP 2->56|2ey4C1|6.6e-07|38.2|55/0|b.43.3.5|1/1|Translation proteins| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 55 STR:RPRED 83.3 SQ:SECSTR EEEccccccTTcEEEcTTccEEEEEEEEEccccccEEEEEccccGGGGTTcEEEE########### DISOP:02AL 60-66| PSIPRED cEEEEccccEEEEHHHHHHHHHHHHHHHHccccccccEEEEcccccccccEEEEEccHHHHHHHcc //