[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64845.1
DDBJ      :             signal recognition particle
Swiss-Prot:SRP19_PYRAE  RecName: Full=Signal recognition particle 19 kDa protein;         Short=SRP19;

Homologs  Archaea  16/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.201.1
:95 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->93 1kvnA PDBj 2e-12 41.7 %
:RPS:PDB   5->95 3dluC PDBj 7e-18 34.5 %
:RPS:SCOP  2->95 1jidA  d.201.1.1 * 1e-18 19.1 %
:HMM:SCOP  7->94 1lngA_ d.201.1.1 * 1.6e-20 39.1 %
:RPS:PFM   8->60 PF01922 * SRP19 1e-07 43.4 %
:HMM:PFM   8->94 PF01922 * SRP19 6.2e-23 43.0 86/95  
:BLT:SWISS 1->95 SRP19_PYRAE 3e-52 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64845.1 GT:GENE AAL64845.1 GT:PRODUCT signal recognition particle GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1995017..1995304 GB:FROM 1995017 GB:TO 1995304 GB:DIRECTION + GB:PRODUCT signal recognition particle GB:NOTE Protein fate; Protein and peptide secretion and trafficking GB:PROTEIN_ID AAL64845.1 GB:DB_XREF GI:18161572 LENGTH 95 SQ:AASEQ MKKKGGRILWLVYIDASVPRSRGRVLPRGLAVEKPSLKEVVQALEELGYKFQVFPDKKYPPLWFEEKWGYVVVETNEKIREIASKVAGKIREMRR GT:EXON 1|1-95:0| SW:ID SRP19_PYRAE SW:DE RecName: Full=Signal recognition particle 19 kDa protein; Short=SRP19; SW:GN Name=srp19; OrderedLocusNames=PAE3332; SW:KW Complete proteome; Cytoplasm; Ribonucleoprotein; RNA-binding;Signal recognition particle. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->95|SRP19_PYRAE|3e-52|100.0|95/95| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0005786|"GO:signal recognition particle, endoplasmic reticulum targeting"|Signal recognition particle| BL:PDB:NREP 1 BL:PDB:REP 8->93|1kvnA|2e-12|41.7|84/104| RP:PDB:NREP 1 RP:PDB:REP 5->95|3dluC|7e-18|34.5|87/88| RP:PFM:NREP 1 RP:PFM:REP 8->60|PF01922|1e-07|43.4|53/98|SRP19| HM:PFM:NREP 1 HM:PFM:REP 8->94|PF01922|6.2e-23|43.0|86/95|SRP19| GO:PFM:NREP 3 GO:PFM GO:0006614|"GO:SRP-dependent cotranslational protein targeting to membrane"|PF01922|IPR002778| GO:PFM GO:0008312|"GO:7S RNA binding"|PF01922|IPR002778| GO:PFM GO:0048500|"GO:signal recognition particle"|PF01922|IPR002778| RP:SCP:NREP 1 RP:SCP:REP 2->95|1jidA|1e-18|19.1|94/114|d.201.1.1| HM:SCP:REP 7->94|1lngA_|1.6e-20|39.1|87/87|d.201.1.1|1/1|SRP19| OP:NHOMO 17 OP:NHOMOORG 16 OP:PATTERN --1-------------11111111----------1111------------1--11------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 95.8 SQ:SECSTR ####cEEEEcGGGGcTTccTTTTccccTTTccccccHHHHHHHHHHTTcEEEEEEEEEEccccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHH DISOP:02AL 1-2| PSIPRED ccccccEEEEEEEEcccccHHHcccccHHHccccccHHHHHHHHHHccccEEEEcccccccccccccccEEEEEccccHHHHHHHHHHHHHHHcc //