[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64858.1
DDBJ      :             ribosomal protein L7
Swiss-Prot:RL7A_PYRAE   RecName: Full=50S ribosomal protein L7Ae;

Homologs  Archaea  68/68 : Bacteria  0/915 : Eukaryota  162/199 : Viruses  0/175   --->[See Alignment]
d.79.3
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->142 2fc3A PDBj 3e-40 71.8 %
:RPS:PDB   21->137 2czwA PDBj 3e-22 59.8 %
:RPS:SCOP  19->103 1e7kA  d.79.3.1 * 1e-18 38.1 %
:HMM:SCOP  19->137 1s72F_ d.79.3.1 * 2.6e-38 47.9 %
:RPS:PFM   35->122 PF01248 * Ribosomal_L7Ae 1e-14 46.6 %
:HMM:PFM   34->122 PF01248 * Ribosomal_L7Ae 7.1e-31 47.2 89/95  
:BLT:SWISS 1->151 RL7A_PYRAE 6e-75 100.0 %
:PROS 85->102|PS01082|RIBOSOMAL_L7AE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64858.1 GT:GENE AAL64858.1 GT:PRODUCT ribosomal protein L7 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2002697..2003152) GB:FROM 2002697 GB:TO 2003152 GB:DIRECTION - GB:PRODUCT ribosomal protein L7 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL64858.1 GB:DB_XREF GI:18161585 LENGTH 151 SQ:AASEQ MAVTIDPKTFYANPPPGKPFYVRFEVPNDVAEKALEILSIARQTGKIKKGTNETTKAVERGLAKLVLIAEDVDPPEVVAHLPLLCEEKKVPYVYVPSKEKLGKAAGINVSAAAAVVIEPGQAAGELEALVSKINEVRAKHGLNAIPVPAKR GT:EXON 1|1-151:0| SW:ID RL7A_PYRAE SW:DE RecName: Full=50S ribosomal protein L7Ae; SW:GN Name=rpl7ae; OrderedLocusNames=PAE3347; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->151|RL7A_PYRAE|6e-75|100.0|151/151| GO:SWS:NREP 3 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| PROS 85->102|PS01082|RIBOSOMAL_L7AE|PDOC00831| SEG 104->116|aaginvsaaaavv| BL:PDB:NREP 1 BL:PDB:REP 19->142|2fc3A|3e-40|71.8|124/124| RP:PDB:NREP 1 RP:PDB:REP 21->137|2czwA|3e-22|59.8|117/118| RP:PFM:NREP 1 RP:PFM:REP 35->122|PF01248|1e-14|46.6|88/93|Ribosomal_L7Ae| HM:PFM:NREP 1 HM:PFM:REP 34->122|PF01248|7.1e-31|47.2|89/95|Ribosomal_L7Ae| RP:SCP:NREP 1 RP:SCP:REP 19->103|1e7kA|1e-18|38.1|84/125|d.79.3.1| HM:SCP:REP 19->137|1s72F_|2.6e-38|47.9|119/119|d.79.3.1|1/1|L30e-like| OP:NHOMO 377 OP:NHOMOORG 230 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1-222121522322211-111111-11------1111222222---1111111122--11112241111211424-111224444422-12-1-1111111-2223123221-1-1--112-1112-11121-21311--1--11-1---111--1-1124211122321144223222N3231232362232131321 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 86.8 SQ:SECSTR #################cTTcccccccHHHHHHHHHHHHHHHHHcEEEEcHHHHHHHHHTTcccEEEEETTcccGGGTTTHHHHHHHHTccEEEEccHHHHHHHHTccccccEEEEEEcGGGHHHHHHHHHHHHHHTHTTcccEEccc### DISOP:02AL 1-6, 148-151| PSIPRED cccccccccccccccccccEEEcccccHHHHHHHHHHHHHHHccccEEEcHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccEEEEccHHHHHHHHcccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccccc //