[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64861.1
DDBJ      :             branched-chain amino acid binding protein
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  324/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:449 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   67->405 2lbpA PDBj 1e-12 26.5 %
:RPS:PDB   71->414 3ckmA PDBj 3e-34 15.1 %
:RPS:SCOP  68->413 1usgA  c.93.1.1 * 7e-52 21.6 %
:HMM:SCOP  60->441 1ewkA_ c.93.1.1 * 1.6e-67 29.3 %
:RPS:PFM   89->406 PF01094 * ANF_receptor 9e-34 38.9 %
:HMM:PFM   88->414 PF01094 * ANF_receptor 1.2e-49 27.0 319/348  
:HMM:PFM   6->55 PF03748 * FliL 0.0002 15.0 40/149  
:BLT:SWISS 66->420 Y1266_METJA 3e-49 36.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64861.1 GT:GENE AAL64861.1 GT:PRODUCT branched-chain amino acid binding protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 2005342..2006691 GB:FROM 2005342 GB:TO 2006691 GB:DIRECTION + GB:PRODUCT branched-chain amino acid binding protein GB:NOTE Transport and binding proteins; Amino acids, peptides and amines GB:PROTEIN_ID AAL64861.1 GB:DB_XREF GI:18161589 LENGTH 449 SQ:AASEQ MASKTLYIGIIVAVVIIAIAAALLSMGGGQQTPTQSPTTPRPTQSPTSPTATPTQTPTQTSPTPTKKTVYIGAALPLTGGSQSYGIGVKNAVELAVEDANKMCPNIKFELLVEDTGTNPQQALQKVQTLYAKGARLIVGPMTSGEVSAVKSFADQNKIIIFSPSSTSPLLGIPGDWVYRIVPTDFAQAAAIADLLKTLGVKRAVIIYRNDAWGVGLRNAITNESNKLGINIVASQGYDPDPKAFPTAVPEAIRKLSGALGQPGSDAAIIFVTFEDDGIAAIQAAASDPVLSKVRWIGTDGIAYSDALIKQVGKEMAAAKMLGTIAAPDPNDPKYQEFKQRYKAKYGKDPVAYDPYGYDAAMMLMQIACQLGTDDSDKVKATLEQWGRQGTYQGVTGKVYLDEAGDRAYPNYVIWGVALEGGQPKYVDAAYYYGTDRKITIFDQGKQFFQ GT:EXON 1|1-449:0| BL:SWS:NREP 1 BL:SWS:REP 66->420|Y1266_METJA|3e-49|36.2|348/417| TM:NTM 1 TM:REGION 6->27| SEG 10->22|iivavviiaiaaa| SEG 30->65|qqtptqspttprptqsptsptatptqtptqtsptpt| BL:PDB:NREP 1 BL:PDB:REP 67->405|2lbpA|1e-12|26.5|317/346| RP:PDB:NREP 1 RP:PDB:REP 71->414|3ckmA|3e-34|15.1|298/309| RP:PFM:NREP 1 RP:PFM:REP 89->406|PF01094|9e-34|38.9|301/319|ANF_receptor| HM:PFM:NREP 2 HM:PFM:REP 88->414|PF01094|1.2e-49|27.0|319/348|ANF_receptor| HM:PFM:REP 6->55|PF03748|0.0002|15.0|40/149|FliL| RP:SCP:NREP 1 RP:SCP:REP 68->413|1usgA|7e-52|21.6|328/345|c.93.1.1| HM:SCP:REP 60->441|1ewkA_|1.6e-67|29.3|369/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 789 OP:NHOMOORG 356 OP:PATTERN 22-2-1--11--1-1-2-3333312---2--1----1------111-2-----------1----3-41 --------------1------1---1------1111-1--13231----11------111-11-11-111112221111---2--------------------------------------------1-11--2--1--11---22211-1111111------11-1111-------------422--11-----------------------------111---------3--------------------------------11--------------------1-----------------------------111----221-41111111-1---------1----3--53222161--11---2-121---------1--23321111522122322332333-1141-61222--32223243222353----11--1-12---------2----422-----------------------------1-----45444A9CBDA45554BB97665644C993553-1334-1322362314135----33----------2251441116226333313334152-222224116---1-111111----------11----11--1--------------------------------------1-2--1-1111111111-11111111-1111-11---111---------------------21111111-----------------------------112-------------------------2-2222-2-11-1111112----------------------------------------1---------------1---------------------------11---11111-1- ----1---------------------------------------------------------------------------------------------------------3--------------------------------------------------------------------------2--1--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 382 STR:RPRED 85.1 SQ:SECSTR #################################################################cEEEEEEEEEccccTTHHHHHHHHHHHHHHHTTccHHcEEEEccEEEEETTccHHHHHHHHHHHHHTTccEEEccccHHHHHHHHHcGGGGTTEEEEccccTTccccTTTTEEEccccHHHHHHHHHHHHHHHTTccccEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEccTTHHHHHHHHHHHHTHHHHHHHccTTccEEEEcccHHHHHHHHHHTTTcTccTcEEEEcGGGccHHHHTcHHHHHHTTcEEEEcGGGGccccHHHHHHHHHTTTcHHHGGccHHHHHHHHHHHHHHHHTTccHHHHHHHTHHHHHHcTTccEEETTEEEEEcTTccEEEEEEEEEEEEcTTccEEEEE#EEEETTTccEEEcTTccccc# DISOP:02AL 1-8, 30-51, 444-445, 448-449| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHcccEEEEEccccccccccccEEEEEccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccEEEEEEccccccccccEEEEEEEEEccEEEEEEEEEEEccccEEEEEEccEEccc //