[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64884.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->140 2afiO PDBj 6e-07 17.2 %
:RPS:SCOP  7->158 1cp2A  c.37.1.10 * 1e-09 16.0 %
:HMM:SCOP  3->218 1ionA_ c.37.1.10 * 1.6e-12 23.9 %
:RPS:PFM   7->29 PF07015 * VirC1 1e-04 69.6 %
:HMM:PFM   7->116 PF01656 * CbiA 3.2e-11 38.2 76/194  
:BLT:SWISS 7->163 SOJ_BACSU 1e-04 29.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64884.1 GT:GENE AAL64884.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2029927..2030595) GB:FROM 2029927 GB:TO 2030595 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64884.1 GB:DB_XREF GI:18161614 LENGTH 222 SQ:AASEQ MIRTGTVAFTSCKGGAGKTTLAVNVSAALPLNVLLIDLGGGASRFFPAPLINIENITPTIEAYRDARVKNLFVIPIAIDPASVWRIENWEEIFQNLTDAVRKNIVKNSIDVVVLDMYQLSRITPIETFGLDKADLIVLVVEGCEDCTKPITIIKKFFDGKLIIALNKHERGIEYPGAVVKIPFSATLDYYNRRGQFYTKPVTKLAEYLLQELKRVTRSRWIE GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 7->163|SOJ_BACSU|1e-04|29.2|154/253| RP:PDB:NREP 1 RP:PDB:REP 7->140|2afiO|6e-07|17.2|134/262| RP:PFM:NREP 1 RP:PFM:REP 7->29|PF07015|1e-04|69.6|23/197|VirC1| HM:PFM:NREP 1 HM:PFM:REP 7->116|PF01656|3.2e-11|38.2|76/194|CbiA| RP:SCP:NREP 1 RP:SCP:REP 7->158|1cp2A|1e-09|16.0|150/269|c.37.1.10| HM:SCP:REP 3->218|1ionA_|1.6e-12|23.9|197/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------11--1--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 91.9 SQ:SECSTR ##cccEEEEEEEcTTccHHHHHHHHHHHHHccEEEEcTTccccHHHHTccccccHHHHHHHHccTTcccHHHHcEEcGGGcEEEcccTTHHHHHHHHHHHHTTcccccccEEEEEccccccTTTTHHHHTTTccEEEEEccccHHHHHHHHHHHHHHcccccEEETTTTcccccHHHHHHHHHTcEEEEEEccc######ccccHHHHHHHH########## DISOP:02AL 1-2| PSIPRED cccccEEEEEEcccccccEEEEEEEEccccEEEEEEEccccccccccccEEEccccccHHHHHHcccccEEEEEEEEEccHHHEEEccHHHHHHHHHHHHHHHHHHccccEEEEEHHHHcccccHHHcccccccEEEEEEEccccHHHHHHHHHHHHccEEEEEEcccccccccccEEEEEEHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHHHHHHccc //