[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64895.1
DDBJ      :             sugar transport permease protein
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  264/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:286 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   123->233 PF02653 * BPD_transp_2 1e-04 34.5 %
:HMM:PFM   8->250 PF02653 * BPD_transp_2 1.1e-23 27.4 234/267  
:BLT:SWISS 7->247 YUFQ_BACSU 1e-13 25.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64895.1 GT:GENE AAL64895.1 GT:PRODUCT sugar transport permease protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2039154..2040014) GB:FROM 2039154 GB:TO 2040014 GB:DIRECTION - GB:PRODUCT sugar transport permease protein GB:NOTE Transport and binding proteins; Carbohydrates, organic alcohols, and acids GB:PROTEIN_ID AAL64895.1 GB:DB_XREF GI:18161626 LENGTH 286 SQ:AASEQ MAVELPIILEALKGATPILLATLGAIIGQRAGVLNLGLEGVVYLSAAVAAATGPPWGYILAIAVGVIYNLLYYVLANDLALNQVLLGFAFTMIAYGIGSQAAKEIVGRPIEKPLVQGYEAYFIAGLVALAVYFLFRTRTGIVIKASGDDPASLDLMGVDVYRIRKLAGVLEGALASSAGAYLVLIYYGNWSEPLVMGWGTLAVITAMISLWNPLIAIIASLAPSLFITLSYTLQRYTQISPHLLNTIPYLASAIILIAVQMLMRKTRLKALAPKWLAKAYVREERM GT:EXON 1|1-286:0| BL:SWS:NREP 1 BL:SWS:REP 7->247|YUFQ_BACSU|1e-13|25.7|237/319| TM:NTM 8 TM:REGION 2->24| TM:REGION 28->50| TM:REGION 58->80| TM:REGION 82->104| TM:REGION 115->136| TM:REGION 166->188| TM:REGION 202->224| TM:REGION 242->263| SEG 268->279|lkalapkwlaka| RP:PFM:NREP 1 RP:PFM:REP 123->233|PF02653|1e-04|34.5|110/271|BPD_transp_2| HM:PFM:NREP 1 HM:PFM:REP 8->250|PF02653|1.1e-23|27.4|234/267|BPD_transp_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| OP:NHOMO 380 OP:NHOMOORG 288 OP:PATTERN 222-11------------2223212--11-1-----------------------111-111---2--- --1----------------------------------------------------------------1----------1---1------------------------------------------111-11--111---1----11-------12------------1111------------11-1111-111--1-111111111111---11111111111111111122--------------------11-1--1--1----------1111--11111-11--111-1--1-1-11111111111111111111111111121111111-111---2111311111--11---2-1111111111-1--------------222-----1--11111111111-------1-24--422443444455-----3312222122---------11----1-----------------------------------1-----------------31--------21111--111411-111-222-2-----1------------1-2-2---22--111-----------1111-1-----------------------------1-1-------1--------------1--1----------------------------------------------------------------------------------------------------------------2-2---------------------1----11111-11-----12-1-------------------------------------------------11111-11111---------------------1---1521112111--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 283-286| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHccccccccccc //