[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64913.1
DDBJ      :             ribosomal protein L15
Swiss-Prot:RL15_PYRAE   RecName: Full=50S ribosomal protein L15P;

Homologs  Archaea  45/68 : Bacteria  0/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
c.12.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->151 1s1iV PDBj 5e-10 34.6 %
:RPS:PDB   15->151 3bboN PDBj 2e-15 14.3 %
:RPS:SCOP  9->151 1jj2K  c.12.1.1 * 2e-14 31.1 %
:HMM:SCOP  6->151 1ffkJ_ c.12.1.1 * 1.3e-30 36.8 %
:HMM:PFM   21->150 PF00828 * Ribosomal_L18e 6.5e-36 41.6 125/129  
:BLT:SWISS 1->156 RL15_PYRAE 2e-85 100.0 %
:PROS 115->145|PS00475|RIBOSOMAL_L15
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64913.1 GT:GENE AAL64913.1 GT:PRODUCT ribosomal protein L15 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2059775..2060245) GB:FROM 2059775 GB:TO 2060245 GB:DIRECTION - GB:PRODUCT ribosomal protein L15 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL64913.1 GB:DB_XREF GI:18161645 LENGTH 156 SQ:AASEQ MVRRFKRGTKYRRGSRTHGWGRVGQHRKSGGSGGKGMVGFHKHKWSLVMKYGESGTGWPFYGKHGFKQPPPISIEWRPINVGTLAELVKELKAEGKVREEGGKYVINLLELGFNKLLGGGTIDLPVIVYTPIASRTAVEKIEKAGGEVRIIHVIHR GT:EXON 1|1-156:0| SW:ID RL15_PYRAE SW:DE RecName: Full=50S ribosomal protein L15P; SW:GN Name=rpl15p; OrderedLocusNames=PAE3436; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->156|RL15_PYRAE|2e-85|100.0|156/156| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 115->145|PS00475|RIBOSOMAL_L15|PDOC00386| SEG 28->36|ksggsggkg| BL:PDB:NREP 1 BL:PDB:REP 9->151|1s1iV|5e-10|34.6|136/143| RP:PDB:NREP 1 RP:PDB:REP 15->151|3bboN|2e-15|14.3|126/176| HM:PFM:NREP 1 HM:PFM:REP 21->150|PF00828|6.5e-36|41.6|125/129|Ribosomal_L18e| RP:SCP:NREP 1 RP:SCP:REP 9->151|1jj2K|2e-14|31.1|132/145|c.12.1.1| HM:SCP:REP 6->151|1ffkJ_|1.3e-30|36.8|136/151|c.12.1.1|1/1|Ribosomal proteins L15p and L18e| OP:NHOMO 70 OP:NHOMOORG 63 OP:PATTERN 11111111111111111111211---------11111111111-------11111--111---11-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------2-2------1-1--11111----------------------1----------------1-------------1---------1-----111----4-------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 91.7 SQ:SECSTR ######cHTTccTTcccccccccccGGGTcccccTTccTTcccccccTTccccc##TcccccccccccccccccccccccccccccccTTTTTTTccccccccccccccccccccccccccccccccccccccTGGGTTccTTTTccEEcc##### DISOP:02AL 1-43| PSIPRED cccccccccccccccEEccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccEEEEEEHHHHHHHccccccccEEEccccEEEEEEEccccEEEEEcccccccEEEEEccccHHHHHHHHHcccEEEEEEEEEc //