[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64914.1
DDBJ      :             glucokinase (ROK family protein), conjectural
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  348/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:296 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->167 1z05A PDBj 3e-13 37.4 %
:BLT:PDB   156->281 2ap1A PDBj 1e-12 35.0 %
:RPS:PDB   4->282 2aa4A PDBj 5e-35 29.7 %
:RPS:SCOP  4->106 2aa4A1  c.55.1.10 * 4e-15 28.2 %
:RPS:SCOP  112->292 2gupA2  c.55.1.10 * 3e-27 17.6 %
:HMM:SCOP  1->290 1sz2A1 c.55.1.7 * 2.5e-47 32.1 %
:RPS:PFM   6->175 PF00480 * ROK 3e-25 42.0 %
:HMM:PFM   6->173 PF00480 * ROK 1.4e-32 38.3 167/179  
:BLT:SWISS 1->289 GLK_STRLI 6e-18 32.2 %
:PROS 140->149|PS00142|ZINC_PROTEASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64914.1 GT:GENE AAL64914.1 GT:PRODUCT glucokinase (ROK family protein), conjectural GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2060281..2061171) GB:FROM 2060281 GB:TO 2061171 GB:DIRECTION - GB:PRODUCT glucokinase (ROK family protein), conjectural GB:NOTE Energy metabolism; Sugars GB:PROTEIN_ID AAL64914.1 GB:DB_XREF GI:18161646 LENGTH 296 SQ:AASEQ MTLYLGIDVGATWTRAILIDENLQVFKRLKIRTGVNPLADVAVAVEKWSFDSIGVGSIGPMDLRSGRVVNSPNSPSRQFPLVEPLKKFGKPVVVANDCVAAVWGEYVFKHRVENLVYVTLSTGVGIGAIVNGTLLLGKDGNAHELGHAVIDFRSSRQCGCGGFGHFEAYVGGANIPKWFQELTGEALNDAAEVFKRYRDGDFKARQFIDLWLDALAAGIATVIAAYDPELLIIGGSIGLNNWDIISRDLPIRLKKYLGVRPPAITQASFGDDEVAIGAAALAYRVPESLKKFGYPR GT:EXON 1|1-296:0| BL:SWS:NREP 1 BL:SWS:REP 1->289|GLK_STRLI|6e-18|32.2|283/317| PROS 140->149|PS00142|ZINC_PROTEASE|PDOC00129| SEG 214->225|alaagiatviaa| BL:PDB:NREP 2 BL:PDB:REP 52->167|1z05A|3e-13|37.4|115/396| BL:PDB:REP 156->281|2ap1A|1e-12|35.0|123/305| RP:PDB:NREP 1 RP:PDB:REP 4->282|2aa4A|5e-35|29.7|273/289| RP:PFM:NREP 1 RP:PFM:REP 6->175|PF00480|3e-25|42.0|169/181|ROK| HM:PFM:NREP 1 HM:PFM:REP 6->173|PF00480|1.4e-32|38.3|167/179|ROK| RP:SCP:NREP 2 RP:SCP:REP 4->106|2aa4A1|4e-15|28.2|103/119|c.55.1.10| RP:SCP:REP 112->292|2gupA2|3e-27|17.6|170/175|c.55.1.10| HM:SCP:REP 1->290|1sz2A1|2.5e-47|32.1|280/0|c.55.1.7|1/1|Actin-like ATPase domain| OP:NHOMO 620 OP:NHOMOORG 375 OP:PATTERN 11111-----------1111111-1111111-------------1111-------------111---- -22-211111111--------1---1----------1111--12-211-11-3-2--211222211-232211111331-1-1-11-1112112-1----1----1-1----------------1-----------122211114-1-------------------1221-------------1-1--44-2-11111111111211121122--11111-12--11111-22---------------1---12---11---------11-1---1--1----------11111111111-----------------------12-1511111112121-11-11111-1-2---------13111545-1-----1--------1----------------------1-11111-11-1--2--311-111-----------1---11-------------------------------------------------------------------------------------------111--1121----111------------------------------1-1----------1------------------------------114-1----121-111---222-------1------1------32521213333333333-333333333333322322211133--12122122222222222421333331-433343332443------------------222121-22221231-----------1---------------------------13234444413133------------------111111-------------------1-1---------1----1221123222-11 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEcccEEEEEEEcTTccEEEEEEEEcccccHHHHHHHHTTTGccEEEEEEccEEETTEEEcccGGGGGGTTccHHHHHHHHcccEEEEEHHHHHHHHHHHTcTTcccEEEEEEcccEEEEEEETTEEEccTTcccccGGGccccHTTccccTTcccccHHHHHcHHHHHHTccGGTTcccccHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHTcTTHHHHHHHHHHHTTccGGGccEEEEccccccHHHHHHHHHHHHccTTEEEEHHHH DISOP:02AL 294-296| PSIPRED ccEEEEEEEcccEEEEEEEcccccEEEEEEccccHHHHHHHHHHHHHccEEEEEEEcccEEEccccEEEEccccccccccHHHHHHHccccEEEEccHHHHHHHHHHHccccccEEEEEEcccccEEEEEccEEEcccccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHcccc //