[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64939.1
DDBJ      :             transcriptional regulatory protein, AsnC family, putative
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:85 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->72 2z4pA PDBj 1e-12 37.1 %
:RPS:PDB   1->77 2djwH PDBj 3e-14 27.3 %
:RPS:SCOP  1->77 1i1gA2  d.58.4.2 * 1e-13 23.4 %
:HMM:SCOP  1->83 2cg4A2 d.58.4.2 * 1e-15 32.5 %
:RPS:PFM   13->76 PF01037 * AsnC_trans_reg 3e-07 37.5 %
:HMM:PFM   8->75 PF01037 * AsnC_trans_reg 1.4e-20 30.9 68/74  
:BLT:SWISS 2->73 REG3_PYRAB 1e-09 36.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64939.1 GT:GENE AAL64939.1 GT:PRODUCT transcriptional regulatory protein, AsnC family, putative GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2085604..2085861) GB:FROM 2085604 GB:TO 2085861 GB:DIRECTION - GB:PRODUCT transcriptional regulatory protein, AsnC family, putative GB:NOTE Regulatory functions; General GB:PROTEIN_ID AAL64939.1 GB:DB_XREF GI:18161674 LENGTH 85 SQ:AASEQ MEAVVFLNVDIGAEDRVMEELAAIPEVKAVYFVYGPYDIIIKIDAPDIEKIRSIVRDKVRKIEGIRSTTTLVVAKSHVKTSPPHA GT:EXON 1|1-85:0| BL:SWS:NREP 1 BL:SWS:REP 2->73|REG3_PYRAB|1e-09|36.1|72/158| BL:PDB:NREP 1 BL:PDB:REP 3->72|2z4pA|1e-12|37.1|70/75| RP:PDB:NREP 1 RP:PDB:REP 1->77|2djwH|3e-14|27.3|77/79| RP:PFM:NREP 1 RP:PFM:REP 13->76|PF01037|3e-07|37.5|64/74|AsnC_trans_reg| HM:PFM:NREP 1 HM:PFM:REP 8->75|PF01037|1.4e-20|30.9|68/74|AsnC_trans_reg| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01037|IPR019887| GO:PFM GO:0005622|"GO:intracellular"|PF01037|IPR019887| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01037|IPR019887| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01037|IPR019887| RP:SCP:NREP 1 RP:SCP:REP 1->77|1i1gA2|1e-13|23.4|77/80|d.58.4.2| HM:SCP:REP 1->83|2cg4A2|1e-15|32.5|83/0|d.58.4.2|1/1|Dimeric alpha+beta barrel| OP:NHOMO 35 OP:NHOMOORG 24 OP:PATTERN 11112111--------1-22222-------------------------------1111212----123 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 83 STR:RPRED 97.6 SQ:SECSTR EEEEEEEEEcTTTHHHHHHHHHTcTTEEEEEEccccccEEEEEEEcccTTHHHHTTTTGGGcTTEEEEEEEEccccccccccc## DISOP:02AL 82-85| PSIPRED cEEEEEEEEcccHHHHHHHHHHcccHHEEEEEEccccEEEEEEEEccHHHHHHHHHHHHHccccccEEEEEEEEEEEEccccccc //