[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64941.1
DDBJ      :             transcriptional regulatory protein, AsnC family, putative
Swiss-Prot:             

Homologs  Archaea  51/68 : Bacteria  446/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.58.4
:168 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->152 2znzC PDBj 2e-22 40.3 %
:RPS:PDB   1->163 2e1cA PDBj 2e-19 38.6 %
:RPS:SCOP  1->60 1i1gA1  a.4.5.32 * 7e-17 31.7 %
:RPS:SCOP  63->163 2cg4A2  d.58.4.2 * 1e-12 30.6 %
:HMM:SCOP  1->61 2cg4A1 a.4.5.32 * 3.1e-16 45.9 %
:HMM:SCOP  61->155 1i1gA2 d.58.4.2 * 1.3e-12 49.4 %
:RPS:PFM   5->48 PF08279 * HTH_11 3e-05 45.5 %
:RPS:PFM   85->152 PF01037 * AsnC_trans_reg 9e-11 53.2 %
:HMM:PFM   67->153 PF01037 * AsnC_trans_reg 1e-27 54.1 74/74  
:HMM:PFM   9->47 PF01978 * TrmB 2e-06 31.6 38/68  
:BLT:SWISS 1->152 REG6_PYRAB 4e-23 41.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64941.1 GT:GENE AAL64941.1 GT:PRODUCT transcriptional regulatory protein, AsnC family, putative GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2086419..2086925) GB:FROM 2086419 GB:TO 2086925 GB:DIRECTION - GB:PRODUCT transcriptional regulatory protein, AsnC family, putative GB:NOTE Regulatory functions; General GB:PROTEIN_ID AAL64941.1 GB:DB_XREF GI:18161676 LENGTH 168 SQ:AASEQ MDEIDRKLITLLQANGKKTLQELSEEIGKPKTTLAARIKKLENDGVIIGYKAVVNPFALGYKLLAFVLVSVRRGAAPKEAKPLQLEVAEKVLAECNGEGGLPYVEEAYVITGPYDLLFKVWSRDVKQLSTFLVTYLASNPDIQRTETLIVLEIVDDWRRRVMPPATTG GT:EXON 1|1-168:0| BL:SWS:NREP 1 BL:SWS:REP 1->152|REG6_PYRAB|4e-23|41.9|136/151| BL:PDB:NREP 1 BL:PDB:REP 3->152|2znzC|2e-22|40.3|134/144| RP:PDB:NREP 1 RP:PDB:REP 1->163|2e1cA|2e-19|38.6|145/147| RP:PFM:NREP 2 RP:PFM:REP 5->48|PF08279|3e-05|45.5|44/52|HTH_11| RP:PFM:REP 85->152|PF01037|9e-11|53.2|62/74|AsnC_trans_reg| HM:PFM:NREP 2 HM:PFM:REP 67->153|PF01037|1e-27|54.1|74/74|AsnC_trans_reg| HM:PFM:REP 9->47|PF01978|2e-06|31.6|38/68|TrmB| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01037|IPR019887| GO:PFM GO:0005622|"GO:intracellular"|PF01037|IPR019887| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01037|IPR019887| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01037|IPR019887| RP:SCP:NREP 2 RP:SCP:REP 1->60|1i1gA1|7e-17|31.7|60/60|a.4.5.32| RP:SCP:REP 63->163|2cg4A2|1e-12|30.6|85/86|d.58.4.2| HM:SCP:REP 1->61|2cg4A1|3.1e-16|45.9|61/0|a.4.5.32|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 61->155|1i1gA2|1.3e-12|49.4|77/0|d.58.4.2|1/1|Dimeric alpha+beta barrel| OP:NHOMO 1467 OP:NHOMOORG 502 OP:PATTERN --112112111111123111111112211-21-1-11111111---1-------55545551114--1 -1--8------1--51123-22--3-2222243222-38511-131---22-34412---341-422764------------------22221311---31424233412---------------11-----------------11-------------------------------------31---------111111112111111-1---2122---1111------22---------------------------1-----11-----------------------------------------------------------1----------12-------1-----11-111--------------1--3221-----116461113224266666665667-112114115A1-966778D77856431-14353533567--------23321114------------------------------14442555679BBAD8777768888888857BA75544--333224354-5152221----522222212---131--1-111--13----1-1----------1------------------------------332121124523222223322224244222--1----------22342333333333333-3333333333333333333444342333333333333233333333333332-211111111111---3-----1111--22822223222222211267555441113122224623256442233---------2445433333667441111111111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1--1--------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 97.0 SQ:SECSTR ccHHHHHHHHHHHHcTTccHHHHHHHHTccHHHHHHHHHHHHHTTccccccccccGGGGTccEEEEEEEEEcTTcHHHHHHHHHTccGGGHHHHHHHHHTcTTEEEEEEccccccEEEEEEEccHHHHHHHHHHHHHHcTTEEEEEEEEcccccccccccccc##### DISOP:02AL 164-168| PSIPRED ccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEcHHHHccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccEEEEEEEccHHHHHHHHHHHHHHcccccEEEEEEEEEEEcccccccccccccc //