[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64943.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  62/68 : Bacteria  0/915 : Eukaryota  99/199 : Viruses  0/175   --->[See Alignment]
d.51.1
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->166 1tuaA PDBj 1e-14 29.9 %
:RPS:PDB   37->168 2e3uA PDBj 7e-16 35.4 %
:RPS:SCOP  85->173 1tuaA2  d.51.1.1 * 2e-23 46.1 %
:HMM:SCOP  85->168 1tuaA2 d.51.1.1 * 3.6e-14 34.5 %
:HMM:PFM   107->151 PF00013 * KH_1 7.2e-06 33.3 45/57  
:BLT:SWISS 19->175 Y443_METJA 7e-30 42.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64943.1 GT:GENE AAL64943.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2087662..2088189) GB:FROM 2087662 GB:TO 2088189 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64943.1 GB:DB_XREF GI:18161678 LENGTH 175 SQ:AASEQ MASEYLRGIIYEPIDKKRLRAAREFVKLVDGKYGHRVELDEKQLYIKITPGPEATVDSILKIRDMARAIALGFDPEKALMLENDEYTLAVIELKEYTDKPNHLRRIKGRIIGEEGRAKRTIENLAEVSMVVGDNYVALLGKLDDVEIAKRAVEMIIEGKKHGTVYKFIQSVKRRR GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 19->175|Y443_METJA|7e-30|42.7|157/227| BL:PDB:NREP 1 BL:PDB:REP 10->166|1tuaA|1e-14|29.9|157/189| RP:PDB:NREP 1 RP:PDB:REP 37->168|2e3uA|7e-16|35.4|127/166| HM:PFM:NREP 1 HM:PFM:REP 107->151|PF00013|7.2e-06|33.3|45/57|KH_1| RP:SCP:NREP 1 RP:SCP:REP 85->173|1tuaA2|2e-23|46.1|89/104|d.51.1.1| HM:SCP:REP 85->168|1tuaA2|3.6e-14|34.5|84/104|d.51.1.1|1/1|Eukaryotic type KH-domain (KH-domain type I)| OP:NHOMO 186 OP:NHOMOORG 161 OP:PATTERN 11111111111111111111111111111111111111111111-111--11-11-1111-1111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --11111-211-111-----------------------------------------1-----1---1---11---111111--------111--11---11-1112----22111111--111111-3-161-112-1--1-111-111-1--1-21111111111--1141111-1-18111111--2-1-111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 94.9 SQ:SECSTR #########EEEEccGGEEEEEHHHHHHHHcGGGHHEcTTTcEEEEEEcTTccccHHHHHHHHHHHHHHHTTccHHHHGGGGcTTcEEEEEEGGGccEEEEcHHHHHHHHHcGGGHHHHHHHHHHccEEEEETTEEEEEEcHHHHHHHHHHHHHHHTTccHHHHHHHHccccccH DISOP:02AL 1-2, 173-175| PSIPRED cccHHHHccccccccHHHHcccHHHHHHHHHHccEEEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccccHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHccccccHHHHHHHHHccEEEEEccEEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcc //