[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64944.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  95/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:266 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->235 1ztfA PDBj 1e-31 42.7 %
:HMM:SCOP  37->226 1tqiA2 d.144.1.9 * 1e-22 26.3 %
:RPS:PFM   52->226 PF01163 * RIO1 7e-32 45.1 %
:HMM:PFM   55->227 PF01163 * RIO1 2.1e-48 44.7 170/187  
:BLT:SWISS 7->239 RIO1_ARCFU 1e-38 41.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64944.1 GT:GENE AAL64944.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 2088234..2089034 GB:FROM 2088234 GB:TO 2089034 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64944.1 GB:DB_XREF GI:18161679 LENGTH 266 SQ:AASEQ MGCVRSEKDSDYYKVVDDAINSYAWAAVVKLQERRVITDVLGPIGQGKEAKIILARGADGRYAVLKIFYPVPVRFKRRSPYILGDPRFRNLKISDQLHLVEVWCRKEFGNLSRAYEAGVRVPRPLGFYRNVLAMEFIGVDRNPAPLLAEVGLENIEDPYGLFYDILKNLEKTYVLAGLVHGDLSPFNILYDGQNPWIIDWGSAVRRGHPKEFEYLRRDVERVLEFFGYPLDAEALFKKLVERGAWRGRVEVDEEGWLLIGGKRIID GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 7->239|RIO1_ARCFU|1e-38|41.1|231/258| BL:PDB:NREP 1 BL:PDB:REP 7->235|1ztfA|1e-31|42.7|220/243| RP:PFM:NREP 1 RP:PFM:REP 52->226|PF01163|7e-32|45.1|173/187|RIO1| HM:PFM:NREP 1 HM:PFM:REP 55->227|PF01163|2.1e-48|44.7|170/187|RIO1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01163|IPR018934| GO:PFM GO:0005524|"GO:ATP binding"|PF01163|IPR018934| HM:SCP:REP 37->226|1tqiA2|1e-22|26.3|171/192|d.144.1.9|1/1|Protein kinase-like (PK-like)| OP:NHOMO 642 OP:NHOMOORG 357 OP:PATTERN 22222212111111222222222222211122111221222222222211222422222211111211 ----1-----------------------------------------1---------------1------------------------------------------------------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1---------11----1111---11--1--------------1--1------------------1--111111-----------------------------11---1--111-11111111111-111111------------------1----------------------------------1--------------------1----------1111111-111--1-----------1-11---------------------------1111-111111111111----------1111-------1----11111111--------------------------------------------------------------- 2212223-622222222222221121122121211122122221221122222222112111221111-1111212111212222222-2322211111112122213-344533332123232331215H4-355322232232233223224253333432334343322333111181111111122313254442 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 235 STR:RPRED 88.3 SQ:SECSTR ######TccHHHHHHHHHHccHHHHHHHHHHHHTTcEE#EEEEEEccccEEEEEEEEETTEEEEEEEEEccccccccHHHHTTTcTTcccGGccGGHGHHHHHHHHHHHHHHHHHHTTcccccEEEEETTEEEEEccEETTEEcccHHHHGGGGGGcHHHHHHHHHHHHHHHHHTccEEETTccTTcEEccTTcEEEcccGGEEETTcTTHHHHHHHHHHHHHHHHTccccHHHcHHHHHHH######################## DISOP:02AL 1-5| PSIPRED cccccccccHHHHHHHHHHHcHHHHHHHHHHHHccHHHHHcccccccccEEEEEEEcccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccEEEEEEEccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccEEEEccccEEEEEEccEEEEEEcccEEccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccEEEcccEEEEccEEEcc //