[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64945.1
DDBJ      :             indolepyruvate ferredoxin oxidoreductase beta subunit
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  80/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.64.1
:181 amino acids
:PSIPRED
:RPS:SCOP  25->170 1b0pA4  c.64.1.1 * 4e-04 15.8 %
:HMM:SCOP  1->171 1b0pA4 c.64.1.1 * 8.4e-38 33.9 %
:RPS:PFM   16->181 PF01558 * POR 8e-13 39.4 %
:HMM:PFM   11->170 PF01558 * POR 1.6e-37 36.1 155/173  
:BLT:SWISS 16->171 IORB_PYRAB 1e-25 42.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64945.1 GT:GENE AAL64945.1 GT:PRODUCT indolepyruvate ferredoxin oxidoreductase beta subunit GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2089005..2089550) GB:FROM 2089005 GB:TO 2089550 GB:DIRECTION - GB:PRODUCT indolepyruvate ferredoxin oxidoreductase beta subunit GB:NOTE Energy metabolism; Fermentation GB:PROTEIN_ID AAL64945.1 GB:DB_XREF GI:18161680 LENGTH 181 SQ:AASEQ MATSLVIVGVGGQGVLTLARWIGEAALAEGYDVRIAEVHGMSQRGGSVEVHVRYGKDIYAPIVEEGGADYVIALEALEALRAYKYLKRGGELIVNRRVIQPPGNWLEEEEVFKAILTSGLKSYIVPCFDIAIELGSPLYENAVMLGFFSQLAGLPMPPSLDERNREAFRRGALVYNSLAPY GT:EXON 1|1-181:0| BL:SWS:NREP 1 BL:SWS:REP 16->171|IORB_PYRAB|1e-25|42.9|156/202| TM:NTM 1 TM:REGION 1->23| SEG 6->15|vivgvggqgv| RP:PFM:NREP 1 RP:PFM:REP 16->181|PF01558|8e-13|39.4|160/178|POR| HM:PFM:NREP 1 HM:PFM:REP 11->170|PF01558|1.6e-37|36.1|155/173|POR| GO:PFM:NREP 2 GO:PFM GO:0016903|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors"|PF01558|IPR019752| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01558|IPR019752| RP:SCP:NREP 1 RP:SCP:REP 25->170|1b0pA4|4e-04|15.8|146/253|c.64.1.1| HM:SCP:REP 1->171|1b0pA4|8.4e-38|33.9|171/253|c.64.1.1|1/1|Pyruvate-ferredoxin oxidoreductase, PFOR, domain III| OP:NHOMO 169 OP:NHOMOORG 129 OP:PATTERN --3-12111111111111111111--------111---222221111112222-2222222-111--- -------------------------------------------------------------------------------122------1111-111------------------------------1-11--11-------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2231-----------21------1-1---1-2---1121-2121-121---1------------------11111----------------------------------------------------------------1-1--------------------------------------------------------------------------------------1----------------1-1-23-11--111111-2221221111111--11---------------------11---------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEcccHHHccccEEEEEEEcccccccEEccccccEEEEccHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHcccEEEEEcHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccc //