[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64948.1
DDBJ      :             transcription associated protein, conjectural
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.3
:89 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->30 1i3qI1  g.41.3.1 * 2e-05 26.7 %
:HMM:PFM   1->30 PF02150 * RNA_POL_M_15KD 1.3e-06 37.9 29/35  
:HMM:PFM   23->76 PF09538 * FYDLN_acid 8.4e-06 33.3 54/106  
:BLT:SWISS 1->57 RPOM_SULAC 3e-09 45.6 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64948.1 GT:GENE AAL64948.1 GT:PRODUCT transcription associated protein, conjectural GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 2091399..2091668 GB:FROM 2091399 GB:TO 2091668 GB:DIRECTION + GB:PRODUCT transcription associated protein, conjectural GB:NOTE Transcription; DNA-dependent RNA polymerase GB:PROTEIN_ID AAL64948.1 GB:DB_XREF GI:18161684 LENGTH 89 SQ:AASEQ MRFCPRDGTLMVPYKKDGVTVLKCPKCGYEVKLSEKVKEAYRQKAEVAEDKKRGVMIAEERRAEYDQEEMEELRRQLLENLQETEREGE GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 1->57|RPOM_SULAC|3e-09|45.6|57/111| COIL:NAA 34 COIL:NSEG 1 COIL:REGION 56->89| SEG 67->87|qeemeelrrqllenlqetere| HM:PFM:NREP 2 HM:PFM:REP 1->30|PF02150|1.3e-06|37.9|29/35|RNA_POL_M_15KD| HM:PFM:REP 23->76|PF09538|8.4e-06|33.3|54/106|FYDLN_acid| RP:SCP:NREP 1 RP:SCP:REP 1->30|1i3qI1|2e-05|26.7|30/49|g.41.3.1| OP:NHOMO 14 OP:NHOMOORG 9 OP:PATTERN --1---1--------1-122222--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 36-53, 78-89| PSIPRED cccccccccEEEEEEcccEEEEEcccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccc //