[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64949.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  163/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.257.1
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->139 1sj5A PDBj 2e-23 44.7 %
:RPS:SCOP  61->132 1vjlA  d.257.1.1 * 4e-08 50.0 %
:HMM:SCOP  3->132 1vjlA_ d.257.1.1 * 1e-29 38.1 %
:RPS:PFM   31->132 PF02577 * DUF151 2e-17 48.5 %
:HMM:PFM   24->137 PF02577 * DUF151 2e-40 41.1 112/136  
:BLT:SWISS 26->130 Y1829_MYCTU 4e-14 40.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64949.1 GT:GENE AAL64949.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 2091788..2092249 GB:FROM 2091788 GB:TO 2092249 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64949.1 GB:DB_XREF GI:18161685 LENGTH 153 SQ:AASEQ MVRYLKAELVGLLETVDSYGQVVGIMLIGAEEWGDKAVPIIIGAAETLSIKKGMGEIDFPRPLSHDLFIDILEALGATVEKVTIDALVSSTYTATVYIKDKDGKTHSFDARPSDAVALAVRVNAPIFIADNLEKYAEDLRKYIPPPSGKVTEE GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 26->130|Y1829_MYCTU|4e-14|40.6|101/164| BL:PDB:NREP 1 BL:PDB:REP 25->139|1sj5A|2e-23|44.7|114/143| RP:PFM:NREP 1 RP:PFM:REP 31->132|PF02577|2e-17|48.5|101/137|DUF151| HM:PFM:NREP 1 HM:PFM:REP 24->137|PF02577|2e-40|41.1|112/136|DUF151| RP:SCP:NREP 1 RP:SCP:REP 61->132|1vjlA|4e-08|50.0|72/143|d.257.1.1| HM:SCP:REP 3->132|1vjlA_|1e-29|38.1|126/151|d.257.1.1|1/1|Hypothetical protein TM0160| OP:NHOMO 198 OP:NHOMOORG 189 OP:PATTERN ----------------1111111111111112-----------1--1-1-111--------------- 11111---------11111-11111111111111111111111111-------1---1---11-1111111-------1-1-111222111111--1--1111111211----------------111111111111111111-1111211111111-1---111111111-1-----1-------1111-------------------------------------------------------------------------------------------------------------------------------------1---------------------------1---1----1--1-11111---111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-111111--1--------------1-12-------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111------------------------------------1111111111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----21-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 74.5 SQ:SECSTR ########################EEEEEETTc#cEEEEEEccHHHHHHHHHHHTTcccccccHHHHHHHHHHHTTcEEEEEEEEEEETTEEEEEEEEEcccccEEEEEEcHHHHHHHHHHHTccEEEEHHHHHHcEEc############## DISOP:02AL 147-153| PSIPRED ccEEEEEEEEEEEEcccccccccEEEEEEEEccccEEEEEEEcHHHHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEEEEEEEEccEEEEEEEEEEccccEEEEEccccHHHHHHHHHcccEEEEHHHHHHcccccEEccccccccccc //