[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64950.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:PROS 1->4|PS00228|TUBULIN_B_AUTOREG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64950.1 GT:GENE AAL64950.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2092236..2092475) GB:FROM 2092236 GB:TO 2092475 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64950.1 GB:DB_XREF GI:18161686 LENGTH 79 SQ:AASEQ MRELRSKIETPFDCKYINAVKPDDVDLPEGMEIAHQCVEGRWQIHITYKIKRPEDLLTLKNTIDEIIRALQVIERSIPQ GT:EXON 1|1-79:0| PROS 1->4|PS00228|TUBULIN_B_AUTOREG|PDOC00200| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 78-79| PSIPRED ccHHHHHcccccccEEEccccccccccccHHHHHHHHHcccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccc //