[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64965.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->80 PF06489 * Orthopox_A49R 0.00037 31.5 54/162  
:BLT:SWISS 81->123 FH5_ORYSJ 6e-04 34.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64965.1 GT:GENE AAL64965.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 2102079..2102543 GB:FROM 2102079 GB:TO 2102543 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64965.1 GB:DB_XREF GI:18161702 LENGTH 154 SQ:AASEQ MLAIHLLLVLAVVTHMGLPSATVNTCSFNDVVYVISGQYTWKNYYMPYAIDAWIGDAVTNVPEVYYTYYWDNNSKVLNVIFFDAGPESGYVTYKVYFTTQGACPTEPPKGKEIVLKAYRARVVENVEPVSTKPQSITSTERILPAYKAQIKVTN GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 81->123|FH5_ORYSJ|6e-04|34.9|43/100| SEG 6->13|lllvlavv| HM:PFM:NREP 1 HM:PFM:REP 24->80|PF06489|0.00037|31.5|54/162|Orthopox_A49R| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------11------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,95-95| PSIPRED cHHHHHHHHHHHHHHccccccEEccEEEccEEEEEEcEEEEccccccEEEHHHHHHHHcccccEEEEEEEEccccEEEEEEEEccccccEEEEEEEEEEcccccccccccccHHHHHHHHHHHHccccccccccccccHHHcccEEEEEEEEcc //