[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64979.1
DDBJ      :             surE stationary-phase survival protein homolog
Swiss-Prot:SURE2_PYRAE  RecName: Full=5'-nucleotidase surE2;         EC=3.1.3.5;AltName: Full=Nucleoside 5'-monophosphate phosphohydrolase 2;

Homologs  Archaea  47/68 : Bacteria  542/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
c.106.1
:249 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->224 1l5xB PDBj 4e-30 38.9 %
:RPS:PDB   1->210 2e6cB PDBj 3e-46 34.3 %
:RPS:SCOP  2->224 1l5xA  c.106.1.1 * 2e-46 36.2 %
:HMM:SCOP  1->213 1l5xA_ c.106.1.1 * 2.4e-51 41.0 %
:RPS:PFM   1->161 PF01975 * SurE 1e-20 39.5 %
:HMM:PFM   1->162 PF01975 * SurE 3.4e-45 43.5 161/197  
:BLT:SWISS 1->249 SURE2_PYRAE e-135 100.0 %
:PROS 227->244|PS00216|SUGAR_TRANSPORT_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64979.1 GT:GENE AAL64979.1 GT:PRODUCT surE stationary-phase survival protein homolog GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 2112298..2113047 GB:FROM 2112298 GB:TO 2113047 GB:DIRECTION + GB:PRODUCT surE stationary-phase survival protein homolog GB:NOTE Cellular processes; Adaptations to atypical conditions GB:PROTEIN_ID AAL64979.1 GB:DB_XREF GI:18161716 LENGTH 249 SQ:AASEQ MKIVVTNDDGPHSPLLEPLVRGLEAVGNEVVVVVPERPRSAAGLARTYHKPLRVRRLGGYYVVNGFPADAVFLALKLIAPDAELVISGVNVGENIGIEATYGSGTVGAALQAGVLGVPSIAASMEVGGDVDFMIKVVEGAVASARAGLDGVLAVSINIPSVWKGGVYCVRKLARAVYRERLYEGVDPRGEKYYWRWGPRRSEFEPDTDAYYFYYMRGVTVLGLSESGVASVENFGRKLGQLIGAVKVDC GT:EXON 1|1-249:0| SW:ID SURE2_PYRAE SW:DE RecName: Full=5'-nucleotidase surE2; EC=3.1.3.5;AltName: Full=Nucleoside 5'-monophosphate phosphohydrolase 2; SW:GN Name=surE2; OrderedLocusNames=PAE3523; SW:KW Complete proteome; Cytoplasm; Hydrolase; Metal-binding;Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->249|SURE2_PYRAE|e-135|100.0|249/249| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 227->244|PS00216|SUGAR_TRANSPORT_1|PDOC00190| SEG 29->39|evvvvvperpr| BL:PDB:NREP 1 BL:PDB:REP 2->224|1l5xB|4e-30|38.9|221/272| RP:PDB:NREP 1 RP:PDB:REP 1->210|2e6cB|3e-46|34.3|201/237| RP:PFM:NREP 1 RP:PFM:REP 1->161|PF01975|1e-20|39.5|157/193|SurE| HM:PFM:NREP 1 HM:PFM:REP 1->162|PF01975|3.4e-45|43.5|161/197|SurE| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01975|IPR002828| RP:SCP:NREP 1 RP:SCP:REP 2->224|1l5xA|2e-46|36.2|221/276|c.106.1.1| HM:SCP:REP 1->213|1l5xA_|2.4e-51|41.0|210/276|c.106.1.1|1/1|SurE-like| OP:NHOMO 637 OP:NHOMOORG 597 OP:PATTERN 11---1----------21222221111111111111111111111111111111---11111--1--- -----------------------------------------1----------------------------------------11-111---11111---11-1-12-112-------121----111111111111111--1111-122222122111111-1211122221111111111111112211-----------------------------------------1--------------------------------------------------------------------------------------------1--11111111111--11-----1---1--111111111111111-1--1121111-----111111111111111111111111-11111111111-111111111111111111111111111---------1---121---1---------------------1111-1-111111112222221111122221111112111112-1111111111111111111111111111111111111-1-1-111111112111111111111111111111111111111111111111111111111-1-111111111111111111111111--11111------11--1111111111111-1111111111111111111111--11111111111111111111111111111111111111111---11111111111-1111111111111111111111111-1-1-11111111111111111---------11111111111111111111111111111111-111111---------11-------------------------1111111111-1- -----------1--------------------------------------1------------------------------------------------------------------------------------------------------------------------------1-----1---11-1---1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 224 STR:RPRED 90.0 SQ:SECSTR cEEEEEccccTTcHHHHHHHHHHTTTcEEEEEEEccccccccccccEEEccccTTccccEEEEcccHHHHHHHHHHHHcccccEEEEEEEEccccGGGcTTHcHHHHHHHHHHHTTcEEEEEEEccccccHHHHHHHHHHTTcccccEccccEEEEEccccccEEEEcccccccccEEccEEEEEcTTccEEEEEccEEcccccTTcHHHHHHHTTEEEEEEEc######################### PSIPRED cEEEEEccccccccHHHHHHHHHHHccccEEEEEcccccccccccccccccccEEEEccEEEEccccHHHHHHHHHHccccccEEEEcccccccccHHHHHHccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHccccccEEEEEEccccccHHEEEEEEcccccccccEEEEEcccccEEEEEcccccccccccccHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHcccc //