[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64993.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->84 PF11625 * DUF3253 0.00015 25.0 48/84  
:BLT:SWISS 16->113 NOE2_MOUSE 3e-04 31.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64993.1 GT:GENE AAL64993.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 2127179..2127547 GB:FROM 2127179 GB:TO 2127547 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64993.1 GB:DB_XREF GI:18161732 LENGTH 122 SQ:AASEQ MADIRTLSRTYNGKTDTFRVKLITIRFLREQVQNAKGNLITFRPSKVAQDLQLYGRQDLRAKTVLIRAFLDDLVQRGYITIIKRSARGKVYGLYKSNRYWDMLTIYEPEKVLELLEAEKIQQ GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 16->113|NOE2_MOUSE|3e-04|31.2|93/100| HM:PFM:NREP 1 HM:PFM:REP 34->84|PF11625|0.00015|25.0|48/84|DUF3253| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 121-122| PSIPRED cccHHHHHHHccccccEEEEEHHHHHHHHHHHHcccccEEEEcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccEEEEEEEccccEEEEEEEcccEEEEEEEEcHHHHHHHHHHHHccc //