[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL65026.1
DDBJ      :             conserved protein with 2 CBS domains
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  155/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:139 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->123 2rifD PDBj 3e-17 38.8 %
:RPS:PDB   2->126 2d4zA PDBj 3e-15 12.9 %
:RPS:SCOP  3->128 2yziA1  d.37.1.1 * 7e-22 21.1 %
:HMM:SCOP  6->69 1zfjA2 d.37.1.1 * 1.3e-06 25.0 %
:HMM:SCOP  68->134 1y5hA2 d.37.1.1 * 4.4e-15 32.8 %
:RPS:PFM   1->122 PF00478 * IMPDH 5e-06 27.4 %
:HMM:PFM   4->60 PF00571 * CBS 1.2e-08 25.9 54/57  
:HMM:PFM   70->124 PF00571 * CBS 1.8e-19 34.5 55/57  
:BLT:SWISS 4->124 YBP3_ACIAM 3e-16 33.9 %
:REPEAT 2|3->64|69->128

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL65026.1 GT:GENE AAL65026.1 GT:PRODUCT conserved protein with 2 CBS domains GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(2151986..2152405) GB:FROM 2151986 GB:TO 2152405 GB:DIRECTION - GB:PRODUCT conserved protein with 2 CBS domains GB:NOTE Unclassified GB:PROTEIN_ID AAL65026.1 GB:DB_XREF GI:18161767 LENGTH 139 SQ:AASEQ MKPVESLIRRSAVVITPKESLIQAAEMLAAESIGALAVIDSVTQKKPPAVLSERDIVRAVAMKMPLSTPVEAFMSPGLVTIEEDEDVRKAAKLMTMHNIRHLVVVNKQGELVGVVSIRDVLKELGGKMLNFFYRRKFLY GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 4->124|YBP3_ACIAM|3e-16|33.9|118/164| NREPEAT 1 REPEAT 2|3->64|69->128| BL:PDB:NREP 1 BL:PDB:REP 7->123|2rifD|3e-17|38.8|116/130| RP:PDB:NREP 1 RP:PDB:REP 2->126|2d4zA|3e-15|12.9|124/169| RP:PFM:NREP 1 RP:PFM:REP 1->122|PF00478|5e-06|27.4|113/459|IMPDH| HM:PFM:NREP 2 HM:PFM:REP 4->60|PF00571|1.2e-08|25.9|54/57|CBS| HM:PFM:REP 70->124|PF00571|1.8e-19|34.5|55/57|CBS| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 1 RP:SCP:REP 3->128|2yziA1|7e-22|21.1|123/132|d.37.1.1| HM:SCP:REP 6->69|1zfjA2|1.3e-06|25.0|64/64|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 68->134|1y5hA2|4.4e-15|32.8|67/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 354 OP:NHOMOORG 204 OP:PATTERN 3313-36567676768-2B7CB91-------1--141----1111-3-1-1-12-2111111--2--1 -------------------------------------------------------------------------------------212-----------------2----------------------------------------1--------------------------------------------12111111111111-111-1---1111121---------------------------------------------------------------------------------------------------------------------1---------1-----1-------1-----------1-1112-----1111-1---11-111-11111-11-12111-1-111-----1--11---11--1211111112--------------2------------------------------------------12222-1111111-31111-111111-1-----211--11221--22-1-1-1--------11113------------------2-----11111----------------------------------2--1-------------------------------------------------------------------------------------------------------------------------------------------------------1111111-----1221111-31111-111----------1------------------------------------------------------------------------------------1- -------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------1---------3--3----1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 92.1 SQ:SECSTR cccTTcccccccccEETTccHHHHHHHHHHccccEEEEEccTTTccEEEEEEHHHHHHHHHHHHccccTTcccEEcccccccTTccHHHHHHHHHHHTccEEEEEEGTTEEEEEEEHHHHHHHHHcHH########### PSIPRED cEEHHHccccccEEEcccccHHHHHHHHHHccccEEEEEEcccccEEEEEEEHHHHHHHHHccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHcc //